RegulonDB RegulonDB 10.7: Gene Form
   

yejE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejA yejF yejB yejE yejG5\' TSS_2476 TSS_2476 TSS_2475 TSS_2475

Gene      
Name: yejE    Texpresso search in the literature
Synonym(s): ECK2173, EG12040, b2179
Genome position(nucleotides): 2275273 --> 2276298 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.73
External database links:  
ASAP:
ABE-0007210
ECHOBASE:
EB1974
OU-MICROARRAY:
b2179
PORTECO:
yejE
REGULONDB:
b2179
STRING:
511145.b2179
M3D: yejE
COLOMBOS: yejE
PortEco: b2179


Product      
Name: putative oligopeptide ABC transporter membrane subunit YejE
Synonym(s): YejE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 38.092
Isoelectric point: 9.721
Motif(s):
 
Type Positions Sequence
22 -> 42 YWSLWIFLVLFGLSLCSELIA
202 -> 222 NFWWLLAITVLFGWMSLVGVV
144 -> 164 VLFGLMLTLCSSVMGVLAGAL
158 -> 338 GVLAGALQGYYGGKVDLWGQRFIEVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQALGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQGKNNLQAPWLGITAFLSVAILLSLLIFIGEAVRDAFDPN
308 -> 328 WLGITAFLSVAILLSLLIFIG

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0042884 - microcin transport
GO:0055085 - transmembrane transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11935N
ECOCYC:
YEJE-MONOMER
ECOLIWIKI:
b2179
INTERPRO:
IPR035906
INTERPRO:
IPR025966
INTERPRO:
IPR000515
PFAM:
PF12911
PFAM:
PF00528
PRIDE:
P33915
PROSITE:
PS50928
PROTEINMODELPORTAL:
P33915
REFSEQ:
NP_416684
SMR:
P33915
UNIPROT:
P33915


Operon      
Name: yejABEF         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA rydC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2475 2272388 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2476 2273514 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB