RegulonDB RegulonDB 10.8: Gene Form
   

yejG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejF bcr yejG unknown yejG5\' TSS_2478 TSS_2478 TSS_2477 TSS_2477 yejGp8 yejGp8 yejGp2 yejGp2 yejGp5 yejGp5 yejGp yejGp

Gene      
Name: yejG    Texpresso search in the literature
Synonym(s): ECK2175, EG12042, b2181
Genome position(nucleotides): 2277893 <-- 2278237 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.7
External database links:  
ASAP:
ABE-0007214
ECHOBASE:
EB1976
OU-MICROARRAY:
b2181
PortEco:
yejG
STRING:
511145.b2181
COLOMBOS: yejG


Product      
Name: protein YejG
Synonym(s): YejG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.525
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
4 -> 108 LQLSIVHRLPQNYRWSAGFAGSKVEPIPQNGPCGDNSLVALKLLSPDGDNAWSVMYKLSQALSDIEVPCSVLECEGEPCLFVNRQDEFAATCRLKNFGVAIAEPF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12042-MONOMER
ECOLIWIKI:
b2181
INTERPRO:
IPR020489
PDB:
6BI6
PFAM:
PF13989
PRIDE:
P0AD21
PRODOM:
PD073777
REFSEQ:
NP_416686
SMR:
P0AD21
UNIPROT:
P0AD21


Operon      
Name: yejG         
Operon arrangement:
Transcription unit        Promoter
yejG
yejG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yejGp5 2278353 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yejGp8 2278446 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2477 2278466 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2478 2279068 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB