RegulonDB RegulonDB 10.8: Gene Form
   

yejM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejM yejL proL Fis proLp proLp TSS_2482 (cluster) TSS_2482 (cluster)

Gene      
Name: yejM    Texpresso search in the literature
Synonym(s): ECK2182, EG12049, b2188, pbgA, yejN
Genome position(nucleotides): 2284376 --> 2286136 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.07
External database links:  
ASAP:
ABE-0007240
ECHOBASE:
EB1981
OU-MICROARRAY:
b2188
PortEco:
yejM
STRING:
511145.b2188
COLOMBOS: yejM


Product      
Name: putative cardiolipin transport protein YejM
Synonym(s): PbgA, YejM, YejN
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 67.296
Isoelectric point: 9.399
Motif(s):
 
Type Positions Sequence
347 -> 370 DGFTSPLYRQALLSDFSMPSVRTQ
349 -> 349 F
135 -> 157 WQLMFISVPVILLLELVFATWSW
169 -> 191 FARPLAAFLFIAFIASHVVYIWA
6 -> 252 QRYREKVSQMVSWGHWFALFNILLSLVIGSRYLFIADWPTTLAGRIYSYVSIIGHFSFLVFATYLLILFPLTFIVGSQRLMRFLSVILATAGMTLLLIDSEVFTRFHLHLNPIVWQLVINPDENEMARDWQLMFISVPVILLLELVFATWSWQKLRSLTRRRRFARPLAAFLFIAFIASHVVYIWADANFYRPITMQRANLPLSYPMTARRFLEKHGLLDAQEYQRRLIEQGNPDAVSVQYPLSELR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0008484 - sulfuric ester hydrolase activity
biological_process GO:0055088 - lipid homeostasis
Note(s): Note(s): ...[more].
Reference(s): [1] O'Reilly EK., et al., 2004
External database links:  
ECOCYC:
EG12049-MONOMER
ECOLIWIKI:
b2188
INTERPRO:
IPR000917
INTERPRO:
IPR024588
INTERPRO:
IPR017850
INTERPRO:
IPR012159
MODBASE:
P0AD27
PDB:
5I5H
PFAM:
PF00884
PFAM:
PF11893
PRIDE:
P0AD27
REFSEQ:
NP_416693
SMR:
P0AD27
UNIPROT:
P0AD27


Operon      
Name: yejLM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2482 (cluster) 2285798 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] O'Reilly EK., Kreuzer KN., 2004, Isolation of SOS constitutive mutants of Escherichia coli., J Bacteriol 186(21):7149-60

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB