RegulonDB RegulonDB 10.8: Gene Form
   

ccmH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmF ccmH narP ccmG ccmE ccmHp1 ccmHp1

Gene      
Name: ccmH    Texpresso search in the literature
Synonym(s): ECK2186, EG12052, b2194, yejP
Genome position(nucleotides): 2291358 <-- 2292410 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.04
External database links:  
ASAP:
ABE-0007262
CGSC:
36597
ECHOBASE:
EB1983
OU-MICROARRAY:
b2194
PortEco:
ccmH
STRING:
511145.b2194
COLOMBOS: ccmH


Product      
Name: holocytochrome c synthetase - thiol:disulfide oxidoreductase CcmH
Synonym(s): CcmH, YejP, cytochrome c biogenesis protein CcmH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.089
Isoelectric point: 7.395
Motif(s):
 
Type Positions Sequence
19 -> 350 TIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTPLTVLLWVLPVVAIGIGGWVIYARSRRRVRVVPEAFPEQSVPEGKRAGYVVYLPGIVVALIVAGVSYYQTGNYQQVKIWQQATAQAPALLDRALDPKADPLNEEEMSRLALGMRTQLQKNPGDIEGWIMLGRVGMALGNASIATDAYATAYRLDPKNSDAALGYAEALTRSSDPNDNRLGGELLRQLVRTDHSNIRVLSMYAFNAFEQQRFGEAVAAWEMMLKLLPANDTRRAVIERSIAQAMQHLSPQESK
147 -> 169 YVVYLPGIVVALIVAGVSYYQTG
1 -> 18 MRFLLGVLMLMISGSALA
97 -> 119 LTPLTVLLWVLPVVAIGIGGWVI
222 -> 255 IEGWIMLGRVGMALGNASIATDAYATAYRLDPKN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0015035 - protein disulfide oxidoreductase activity
biological_process GO:0017004 - cytochrome complex assembly
GO:0055114 - oxidation-reduction process
GO:0018378 - cytochrome c-heme linkage via heme-L-cysteine
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48146N
ECOCYC:
EG12052-MONOMER
ECOLIWIKI:
b2194
INTERPRO:
IPR011990
INTERPRO:
IPR038297
INTERPRO:
IPR019734
INTERPRO:
IPR013026
INTERPRO:
IPR005616
MINT:
P0ABM9
MODBASE:
P0ABM9
PFAM:
PF03918
PRIDE:
P0ABM9
PRODB:
PRO_000022263
PROSITE:
PS50293
PROSITE:
PS50005
REFSEQ:
NP_416698
SMR:
P0ABM9
UNIPROT:
P0ABM9


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, FlhDC, ModE, NarP
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ccmHp1 2292621 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB