RegulonDB RegulonDB 10.8: Gene Form
   

ccmG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmF ccmH narP ccmG ccmE ccmD ccmHp1 ccmHp1

Gene      
Name: ccmG    Texpresso search in the literature
Synonym(s): ECK2187, EG12053, b2195, dsbE, yejQ
Genome position(nucleotides): 2292407 <-- 2292964 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.48
External database links:  
ASAP:
ABE-0007264
CGSC:
36594
ECHOBASE:
EB1984
OU-MICROARRAY:
b2195
PortEco:
ccmG
STRING:
511145.b2195
COLOMBOS: ccmG


Product      
Name: holocytochrome c synthetase - thiol:disulfide oxidoreductase CcmG
Synonym(s): CcmG, DsbE, YejQ, thioredoxin-like protein, cytochrome c biogenesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 20.809
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
80 -> 80 C
5 -> 25 VLLIPLIIFLAIAAALLWQLA
6 -> 22 LLIPLIIFLAIAAALLW
39 -> 177 ALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWE
83 -> 83 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0015036 - disulfide oxidoreductase activity
biological_process GO:0017004 - cytochrome complex assembly
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48446N
ECOCYC:
EG12053-MONOMER
ECOLIWIKI:
b2195
INTERPRO:
IPR036249
INTERPRO:
IPR017937
INTERPRO:
IPR013766
INTERPRO:
IPR013740
INTERPRO:
IPR004799
MODBASE:
P0AA86
PDB:
3K8N
PDB:
2G0F
PDB:
2B1L
PDB:
1Z5Y
PDB:
2B1K
PFAM:
PF08534
PRIDE:
P0AA86
PRODB:
PRO_000022483
PROSITE:
PS00194
PROSITE:
PS51352
REFSEQ:
NP_416699
SMR:
P0AA86
UNIPROT:
P0AA86


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, FlhDC, ModE, NarP
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ccmHp1 2292621 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB