RegulonDB RegulonDB 10.8: Gene Form
   

ccmE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmF ccmC ccmG ccmE ccmD ccmH ccmHp1 ccmHp1

Gene      
Name: ccmE    Texpresso search in the literature
Synonym(s): ECK2189, EG12055, b2197, yejS
Genome position(nucleotides): 2294901 <-- 2295380 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.54
External database links:  
ASAP:
ABE-0007271
CGSC:
36587
ECHOBASE:
EB1986
OU-MICROARRAY:
b2197
PortEco:
ccmE
STRING:
511145.b2197
COLOMBOS: ccmE


Product      
Name: periplasmic heme chaperone
Synonym(s): CcmE, YejS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 17.698
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
4 -> 137 RRKNRLWIACAVLAGLALTIGLVLYALRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPP
130 -> 130 H
9 -> 30 LWIACAVLAGLALTIGLVLYAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0020037 - heme binding
biological_process GO:0017004 - cytochrome complex assembly
GO:0015886 - heme transport
GO:0017003 - protein-heme linkage
GO:0018063 - cytochrome c-heme linkage
Note(s): Note(s): ...[more].
Reference(s): [1] Enggist E., et al., 2003
[2] Lee D., et al., 2005
External database links:  
DIP:
DIP-9255N
DISPROT:
DP01729
ECOCYC:
CCME-MONOMER
ECOLIWIKI:
b2197
INTERPRO:
IPR036127
INTERPRO:
IPR004329
MINT:
P69490
MODBASE:
P69490
PANTHER:
PTHR34128
PDB:
1SR3
PFAM:
PF03100
PRIDE:
P69490
PRODB:
PRO_000022261
REFSEQ:
NP_416701
SMR:
P69490
UNIPROT:
P69490


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarP, FlhDC, ModE
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ccmHp1 2292621 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Enggist E., Thony-Meyer L., 2003, The C-terminal flexible domain of the heme chaperone CcmE is important but not essential for its function., J Bacteriol 185(13):3821-7

 [2] Lee D., Pervushin K., Bischof D., Braun M., Thony-Meyer L., 2005, Unusual heme-histidine bond in the active site of a chaperone., J Am Chem Soc 127(11):3716-7

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB