RegulonDB RegulonDB 10.8: Gene Form
   

napB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

napH napG napC napB

Gene      
Name: napB    Texpresso search in the literature
Synonym(s): ECK2195, EG12061, b2203, yejY
Genome position(nucleotides): 2298269 <-- 2298718 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0007283
CGSC:
36560
ECHOBASE:
EB1991
OU-MICROARRAY:
b2203
PortEco:
napB
STRING:
511145.b2203
COLOMBOS: napB


Product      
Name: periplasmic nitrate reductase cytochrome c550 protein
Synonym(s): NapB, YejY, cytochrome c-type protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 16.297
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
28 -> 149 ANGVDFSQSPEVSGTQEGAIRMPKEQDRMPLNYVNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVGNTFTPSKGYGK
127 -> 149 HVPQADTAPIVGNTFTPSKGYGK
40 -> 142 SGTQEGAIRMPKEQDRMPLNYVNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVGNTFT
1 -> 27 MKSHDLKKALCQWTAMLALVVSGAVWA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
biological_process GO:0009061 - anaerobic respiration
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NAPB-MONOMER
ECOLIWIKI:
b2203
INTERPRO:
IPR005591
INTERPRO:
IPR036280
INTERPRO:
IPR011031
MODBASE:
P0ABL3
PANTHER:
PTHR38604
PFAM:
PF03892
PRIDE:
P0ABL3
PRODB:
PRO_000023346
PROSITE:
PS51008
REFSEQ:
NP_416707
SMR:
P0ABL3
SWISSMODEL:
P0ABL3
UNIPROT:
P0ABL3


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, NarP, FlhDC
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB