RegulonDB RegulonDB 10.8: Gene Form
   

napA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

napA napG napF napD napH

Gene      
Name: napA    Texpresso search in the literature
Synonym(s): ECK2198, EG12067, b2206, yojC, yojD, yojE
Genome position(nucleotides): 2300267 <-- 2302753 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.13
External database links:  
ASAP:
ABE-0007289
CGSC:
36550
ECHOBASE:
EB1994
OU-MICROARRAY:
b2206
PortEco:
napA
STRING:
511145.b2206
COLOMBOS: napA


Product      
Name: periplasmic nitrate reductase subunit NapA
Synonym(s): NapA, YojC, YojD, YojE, large subunit of periplasmic nitrate reductase, molybdoprotein
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 93.042
Isoelectric point: 8.141
Motif(s):
 
Type Positions Sequence
1 -> 36 MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQ
6 -> 6 R
10 -> 10 K
37 -> 828 EAIKWDKAPCRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITWDQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVAVLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYADPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREVGTFAHRLPADMVVTNEKHRDICEKKWNIPSGTIPAKIGLHAVAQDRALKDGKLNVYWTMCTNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAERRTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEDLLAKKPELRGKTLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV
212 -> 219 WGANMAEM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0050140 - nitrate reductase (cytochrome) activity
GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0008940 - nitrate reductase activity
GO:0030151 - molybdenum ion binding
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
GO:0009061 - anaerobic respiration
GO:0042128 - nitrate assimilation
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10304N
ECOCYC:
NAPA-MONOMER
ECOLIWIKI:
b2206
INTERPRO:
IPR006963
INTERPRO:
IPR041957
INTERPRO:
IPR027467
INTERPRO:
IPR019546
INTERPRO:
IPR010051
INTERPRO:
IPR009010
INTERPRO:
IPR006657
INTERPRO:
IPR006656
INTERPRO:
IPR006311
MINT:
P33937
MODBASE:
P33937
PANTHER:
PTHR11615:SF123
PDB:
2PQ4
PDB:
2NYA
PFAM:
PF00384
PFAM:
PF04879
PFAM:
PF01568
PRIDE:
P33937
PRODB:
PRO_000023345
PROSITE:
PS51318
PROSITE:
PS51669
PROSITE:
PS00551
REFSEQ:
NP_416710
SMART:
SM00926
SMR:
P33937
UNIPROT:
P33937


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, FlhDC, NarP
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB