RegulonDB RegulonDB 10.8: Gene Form
   

ftp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ada ftp ompC3\' ompC Ada Ada anti-anti-terminator anti-terminator terminator apbEp1 apbEp1 adap adap alkBp alkBp

Gene      
Name: ftp    Texpresso search in the literature
Synonym(s): ECK2206, EG12073, apbE, b2214, yojK, yojL
Genome position(nucleotides): 2310479 <-- 2311534 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.41
External database links:  
ASAP:
ABE-0007317
ECHOBASE:
EB1998
OU-MICROARRAY:
b2214
PortEco:
apbE
STRING:
511145.b2214
COLOMBOS: ftp


Product      
Name: FAD:protein FMN transferase
Synonym(s): ApbE, Ftp, YojK, YojL, flavin transferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 38.549
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
42 -> 325 MGTFWRASIPGIDAKRSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSLSPWPVSEAMADIVTTSLRIGAKTDGAMDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQKDLPDLYVDLSTVGEGYAADHLARLMEQEGISRYLVSVGGALNSRGMNGEGLPWRVAIQKPTDKENAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIEHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVVRREGLAVY
120 -> 122 AMD
79 -> 79 Y
1 -> 19 MEISFTRVALLAAALFFVG
20 -> 351 CDQKPQPAKTHATEVTVLEGKTMGTFWRASIPGIDAKRSAELKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSLSPWPVSEAMADIVTTSLRIGAKTDGAMDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQKDLPDLYVDLSTVGEGYAADHLARLMEQEGISRYLVSVGGALNSRGMNGEGLPWRVAIQKPTDKENAVQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIEHNLVSVTVIAPTALEADAWDTGLMVLGPEKAKEVVRREGLAVYMITKEGDSFKTWMSPQFKSFLVSEKN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0071949 - FAD binding
biological_process GO:0017013 - protein flavinylation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Chan YK., et al., 1997
[2] Deka RK., et al., 2016
[3] Gonnet P., et al., 2004
[4] Juncker AS., et al., 2003
External database links:  
ECOCYC:
EG12073-MONOMER
ECOLIWIKI:
b2214
INTERPRO:
IPR003374
INTERPRO:
IPR024932
INTERPRO:
IPR042159
PANTHER:
PTHR30040
PDB:
4XGX
PDB:
4XGV
PDB:
2O18
PDB:
4XGW
PFAM:
PF02424
PRIDE:
P0AB85
PRODB:
PRO_000022107
PROSITE:
PS51257
REFSEQ:
NP_416718
SMR:
P0AB85
UNIPROT:
P0AB85


Operon      
Name: ftp         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter apbEp1 2311594 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chan YK., McCormick WA., Watson RJ., 1997, A new nos gene downstream from nosDFY is essential for dissimilatory reduction of nitrous oxide by Rhizobium (Sinorhizobium) meliloti., Microbiology 143 ( Pt 8):2817-24

 [2] Deka RK., Brautigam CA., Liu WZ., Tomchick DR., Norgard MV., 2016, Molecular insights into the enzymatic diversity of flavin-trafficking protein (Ftp; formerly ApbE) in flavoprotein biogenesis in the bacterial periplasm., Microbiologyopen 5(1):21-38

 [3] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [4] Juncker AS., Willenbrock H., Von Heijne G., Brunak S., Nielsen H., Krogh A., 2003, Prediction of lipoprotein signal peptides in Gram-negative bacteria., Protein Sci 12(8):1652-62

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB