RegulonDB RegulonDB 10.9: Gene Form
   

nikE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nikC nikE nikD nikR nikB nikRp nikRp TSS_4086 TSS_4086 TSS_4085 TSS_4085 TSS_4084 TSS_4084 TSS_4083 (cluster) TSS_4083 (cluster) TSS_4082 TSS_4082

Gene      
Name: nikE    Texpresso search in the literature
Synonym(s): ECK3464, EG12079, b3480, hydC, hydD
Genome position(nucleotides): 3617776 --> 3618582 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0011362
CGSC:
18223
ECHOBASE:
EB2004
ECOLIHUB:
nikE
OU-MICROARRAY:
b3480
STRING:
511145.b3480
COLOMBOS: nikE


Product      
Name: Ni(2+) ABC transporter ATP binding subunit NikE
Synonym(s): HydC, HydD, NikE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 29.722
Isoelectric point: 10.818
Motif(s):
 
Type Positions Sequence
4 -> 252 LNISGLSHHYAHGGFNGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVGLESPAQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLLSLKKSEQLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQVVGEKLTFSSDAGRVLQN
84 -> 84 R
132 -> 133 SE
176 -> 183 DEAVSNLD
28 -> 179 LNNVSLTLKSGETVALLGRSGCGKSTLARLLVGLESPAQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLLSLKKSEQLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016151 - nickel cation binding
GO:0015413 - ATPase-coupled nickel transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0015675 - nickel cation transport
GO:0035444 - nickel cation transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10344N
ECOCYC:
NIKE-MONOMER
ECOLIWIKI:
b3480
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR014137
INTERPRO:
IPR015858
INTERPRO:
IPR017871
MODBASE:
P33594
PFAM:
PF00005
PRIDE:
P33594
PRODB:
PRO_000023388
PROSITE:
PS51248
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417937
SMART:
SM00382
SMR:
P33594
SWISSMODEL:
P33594
UNIPROT:
P33594


Operon      
Name: nikABCDER         
Operon arrangement:
Transcription unit        Promoter
nikABCDER
nikABCDER
nikR


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL, NikR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4082 3616409 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4083 (cluster) 3616882 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4084 3616908 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4085 3617570 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4086 3617581 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB