RegulonDB RegulonDB 10.8: Gene Form
   

nuoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lrhA nuoB nuoA Fis Fis Fis NarL ArcA IHF IHF IHF FNR TSS_2568 TSS_2568 TSS_2567 (cluster) TSS_2567 (cluster) TSS_2566 (cluster) TSS_2566 (cluster) nuoAp1 nuoAp1 nuoAp2 nuoAp2 TSS_2565 TSS_2565 TSS_2564 TSS_2564 TSS_2563 TSS_2563 TSS_2562 (cluster) TSS_2562 (cluster)

Gene      
Name: nuoA    Texpresso search in the literature
Synonym(s): ECK2282, EG12082, b2288
Genome position(nucleotides): 2404629 <-- 2405072 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.38
External database links:  
ASAP:
ABE-0007553
CGSC:
32679
ECHOBASE:
EB2007
MIM:
252010
MIM:
256000
OU-MICROARRAY:
b2288
PortEco:
nuoA
STRING:
511145.b2288
COLOMBOS: nuoA


Shine dalgarno      
Sequence: gctacttttgATGAGTaagcAAT


Product      
Name: NADH:quinone oxidoreductase subunit A
Synonym(s): NADH:ubiquinone oxidoreductase, membrane subunit A, NuoA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.457
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
28 -> 125 CLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW
82 -> 91 ALYLFAWSTS
98 -> 118 VGFVEAAIFIFVLLAGLVYLV
16 -> 36 FAIFLIVAIGLCCLMLVGGWF
68 -> 88 FYLVAMFFVIFDVEALYLFAW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0050136 - NADH dehydrogenase (quinone) activity
GO:0048038 - quinone binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-59257N
ECOCYC:
NUOA-MONOMER
ECOLIWIKI:
b2288
INTERPRO:
IPR038430
INTERPRO:
IPR023043
INTERPRO:
IPR000440
PANTHER:
PTHR11058
PFAM:
PF00507
PRIDE:
P0AFC3
PRODB:
PRO_000023429
REFSEQ:
NP_416791
SMR:
P0AFC3
UNIPROT:
P0AFC3


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2562 (cluster) 2403951 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2563 2403955 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2564 2404729 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2565 2405136 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2566 (cluster) 2405828 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2567 (cluster) 2406635 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2568 2406641 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB