RegulonDB RegulonDB 10.8: Gene Form
   

nuoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoC nuoB nuoA TSS_2564 TSS_2564 TSS_2563 TSS_2563 TSS_2562 (cluster) TSS_2562 (cluster) TSS_2561 TSS_2561 TSS_2560 TSS_2560 TSS_2559 TSS_2559 TSS_2558 TSS_2558 TSS_2557 (cluster) TSS_2557 (cluster) TSS_2556 (cluster) TSS_2556 (cluster)

Gene      
Name: nuoB    Texpresso search in the literature
Synonym(s): ECK2281, EG12083, b2287
Genome position(nucleotides): 2403951 <-- 2404613 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0007551
CGSC:
32676
ECHOBASE:
EB2008
MIM:
252010
MIM:
256000
OU-MICROARRAY:
b2287
PortEco:
nuoB
STRING:
511145.b2287
COLOMBOS: nuoB


Product      
Name: NADH:quinone oxidoreductase subunit B
Synonym(s): NADH:ubiquinone oxidoreductase, chain B, NuoB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.056
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
64 -> 170 CYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALM
71 -> 71 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0050136 - NADH dehydrogenase (quinone) activity
GO:0048038 - quinone binding
biological_process GO:0009060 - aerobic respiration
GO:0015990 - electron transport coupled proton transport
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Jahn LJ., et al., 2017
External database links:  
ECOCYC:
NUOB-MONOMER
ECOLIWIKI:
b2287
INTERPRO:
IPR006138
INTERPRO:
IPR006137
MODBASE:
P0AFC7
PANTHER:
PTHR11995
PFAM:
PF01058
PRIDE:
P0AFC7
PRODB:
PRO_000023430
PROSITE:
PS01150
REFSEQ:
NP_416790
SMR:
P0AFC7
SWISSMODEL:
P0AFC7
UNIPROT:
P0AFC7


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2556 (cluster) 2402077 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2557 (cluster) 2402082 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2558 2402223 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2559 2402324 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2560 2402420 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2561 2403030 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2562 (cluster) 2403951 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2563 2403955 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2564 2404729 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB