RegulonDB RegulonDB 10.8: Gene Form
   

nuoC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoC nuoB nuoE nuoF TSS_2563 TSS_2563 TSS_2562 (cluster) TSS_2562 (cluster) TSS_2561 TSS_2561 TSS_2560 TSS_2560 TSS_2559 TSS_2559 TSS_2558 TSS_2558 TSS_2557 (cluster) TSS_2557 (cluster) TSS_2556 (cluster) TSS_2556 (cluster) TSS_2555 TSS_2555 TSS_2554 TSS_2554 TSS_2553 TSS_2553 TSS_2552 TSS_2552

Gene      
Name: nuoC    Texpresso search in the literature
Synonym(s): ECK2280, EG12084, b2286, nuoD
Genome position(nucleotides): 2402055 <-- 2403845 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.89
External database links:  
ASAP:
ABE-0007549
CGSC:
32673
ECHOBASE:
EB2009
MIM:
252010
OU-MICROARRAY:
b2286
PortEco:
nuoC
STRING:
511145.b2286
COLOMBOS: nuoC


Product      
Name: NADH:quinone oxidoreductase subunit CD
Synonym(s): NADH:ubiquinone oxidoreductase, chain CD, NuoC, NuoCD, NuoD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 68.236
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
409 -> 412 AYGA
2 -> 186 TDLTAQEPAWQTRDHLDDPVIGELRNRFGPDAFTVQATRTGVPVVWIKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHREGLPAADFSVFYHLISIDRNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKGHPLRKDYPARATEFSPFELTKAKQ
210 -> 596 DFMFLNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLREFLDWMPKRLASYEKAALQNTILKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDCYTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSDLIVYLGSIDFVMSDVDR
46 -> 173 VWIKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHREGLPAADFSVFYHLISIDRNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKGHPLRKDYPARA
366 -> 366 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0016655 - oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0050136 - NADH dehydrogenase (quinone) activity
GO:0048038 - quinone binding
GO:0051287 - NAD binding
biological_process GO:0008152 - metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Jahn LJ., et al., 2017
[2] Knuuti J., et al., 2013
External database links:  
DIP:
DIP-10380N
ECOCYC:
NUOC-MONOMER
ECOLIWIKI:
b2286
INTERPRO:
IPR020396
INTERPRO:
IPR038290
INTERPRO:
IPR037232
INTERPRO:
IPR029014
INTERPRO:
IPR023062
INTERPRO:
IPR022885
INTERPRO:
IPR001135
INTERPRO:
IPR001268
INTERPRO:
IPR010218
INTERPRO:
IPR014029
MINT:
P33599
MODBASE:
P33599
PFAM:
PF00346
PFAM:
PF00329
PRIDE:
P33599
PRODB:
PRO_000023431
PRODOM:
PD001581
PROSITE:
PS00535
PROSITE:
PS00542
REFSEQ:
NP_416789
SMR:
P33599
SWISSMODEL:
P33599
UNIPROT:
P33599


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2552 2401657 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2553 2401712 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2554 2401816 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2555 2401828 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2556 (cluster) 2402077 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2557 (cluster) 2402082 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2558 2402223 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2559 2402324 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2560 2402420 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2561 2403030 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2562 (cluster) 2403951 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2563 2403955 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [2] Knuuti J., Belevich G., Sharma V., Bloch DA., Verkhovskaya M., 2013, A single amino acid residue controls ROS production in the respiratory Complex I from Escherichia coli., Mol Microbiol 90(6):1190-200

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB