RegulonDB RegulonDB 10.8: Gene Form
   

nuoE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoG nuoC nuoF nuoE nuoH Cis-reg TSS_2561 TSS_2561 TSS_2560 TSS_2560 TSS_2559 TSS_2559 TSS_2558 TSS_2558 TSS_2557 (cluster) TSS_2557 (cluster) TSS_2556 (cluster) TSS_2556 (cluster) TSS_2555 TSS_2555 TSS_2554 TSS_2554 TSS_2553 TSS_2553 TSS_2552 TSS_2552 TSS_2551 TSS_2551 TSS_2550 TSS_2550 TSS_2549 TSS_2549 TSS_2548 TSS_2548

Gene      
Name: nuoE    Texpresso search in the literature
Synonym(s): ECK2279, EG12086, b2285
Genome position(nucleotides): 2401552 <-- 2402052 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.29
External database links:  
ASAP:
ABE-0007547
CGSC:
32667
ECHOBASE:
EB2010
OU-MICROARRAY:
b2285
PortEco:
nuoE
STRING:
511145.b2285
COLOMBOS: nuoE


Product      
Name: NADH:quinone oxidoreductase subunit E
Synonym(s): NADH:ubiquinone oxidoreductase, chain E, NuoE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.59
Isoelectric point: 5.499
Motif(s):
 
Type Positions Sequence
22 -> 22 I
23 -> 166 EHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0048038 - quinone binding
biological_process GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Narayanan M., et al., 2013
[2] Pohl T., et al., 2010
External database links:  
DIP:
DIP-35917N
ECOCYC:
NUOE-MONOMER
ECOLIWIKI:
b2285
INTERPRO:
IPR002023
INTERPRO:
IPR036249
INTERPRO:
IPR041921
INTERPRO:
IPR042128
MODBASE:
P0AFD1
PANTHER:
PTHR10371
PFAM:
PF01257
PRIDE:
P0AFD1
PRODB:
PRO_000023432
PROSITE:
PS01099
REFSEQ:
NP_416788
SMR:
P0AFD1
UNIPROT:
P0AFD1


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2548 2397784 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2549 2398792 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2550 2399056 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2551 2401472 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2552 2401657 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2553 2401712 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2554 2401816 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2555 2401828 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2556 (cluster) 2402077 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2557 (cluster) 2402082 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2558 2402223 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2559 2402324 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2560 2402420 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2561 2403030 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Narayanan M., Gabrieli DJ., Leung SA., Elguindy MM., Glaser CA., Saju N., Sinha SC., Nakamaru-Ogiso E., 2013, Semiquinone and cluster N6 signals in His-tagged proton-translocating NADH:ubiquinone oxidoreductase (complex I) from Escherichia coli., J Biol Chem 288(20):14310-9

 [2] Pohl T., Spatzal T., Aksoyoglu M., Schleicher E., Rostas AM., Lay H., Glessner U., Boudon C., Hellwig P., Weber S., Friedrich T., 2010, Spin labeling of the Escherichia coli NADH ubiquinone oxidoreductase (complex I)., Biochim Biophys Acta 1797(12):1894-900

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB