RegulonDB RegulonDB 10.8: Gene Form
   

nuoG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoG nuoF nuoH nuoI nuoE Cis-reg TSS_2551 TSS_2551 TSS_2550 TSS_2550 TSS_2549 TSS_2549 TSS_2548 TSS_2548 TSS_2547 TSS_2547 TSS_2546 TSS_2546 TSS_2545 TSS_2545 TSS_2544 TSS_2544 TSS_2543 TSS_2543 TSS_2542 TSS_2542 TSS_2541 TSS_2541 TSS_2540 TSS_2540

Gene      
Name: nuoG    Texpresso search in the literature
Synonym(s): ECK2277, EG12087, b2283
Genome position(nucleotides): 2397439 <-- 2400165 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.4
External database links:  
ASAP:
ABE-0007543
CGSC:
32661
ECHOBASE:
EB2011
MIM:
252010
OU-MICROARRAY:
b2283
PortEco:
nuoG
STRING:
511145.b2283
COLOMBOS: nuoG


Product      
Name: NADH:quinone oxidoreductase subunit G
Synonym(s): NADH:ubiquinone oxidoreductase, chain G, NuoG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 100.299
Isoelectric point: 6.198
Motif(s):
 
Type Positions Sequence
88 -> 124 RESVVEWLMTNHPHDCPVCEEGGNCHLQDMTVMTGHS
83 -> 122 EAKQFRESVVEWLMTNHPHDCPVCEEGGNCHLQDMTVMTG
562 -> 638 DAVVVLENDLHRHASAIRVNAALAKAPLVMVVDHQRTAIMENAHLVLSAASFAESDGTVINNEGRAQRFFQVYDPAY
3 -> 78 TIHVDGKEYEVNGADNLLEACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNAEDTRGRLVMSCMTPASDGTFIS
188 -> 188 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0048038 - quinone binding
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009060 - aerobic respiration
GO:0045333 - cellular respiration
GO:0042773 - ATP synthesis coupled electron transport
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10383N
ECOCYC:
NUOG-MONOMER
ECOLIWIKI:
b2283
INTERPRO:
IPR001041
INTERPRO:
IPR036010
INTERPRO:
IPR019574
INTERPRO:
IPR010228
INTERPRO:
IPR009010
INTERPRO:
IPR006963
INTERPRO:
IPR000283
INTERPRO:
IPR006656
INTERPRO:
IPR006657
MINT:
MINT-1244767
MODBASE:
P33602
PFAM:
PF00384
PFAM:
PF01568
PFAM:
PF04879
PFAM:
PF10588
PRIDE:
P33602
PRODB:
PRO_000023434
PROSITE:
PS00642
PROSITE:
PS51839
PROSITE:
PS51669
PROSITE:
PS51085
PROSITE:
PS00643
PROSITE:
PS00641
REFSEQ:
NP_416786
SMART:
SM00926
SMART:
SM00929
SMR:
P33602
UNIPROT:
P33602


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


RNA cis-regulatory element    
   
Cis-reg nuoG RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2540 2396044 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2541 2396059 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2542 2396436 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2543 2396485 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2544 2396590 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2545 2396594 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2546 2396596 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2547 2397023 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2548 2397784 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2549 2398792 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2550 2399056 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2551 2401472 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB