RegulonDB RegulonDB 10.8: Gene Form
   

nuoI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoH nuoJ nuoI nuoK nuoG TSS_2547 TSS_2547 TSS_2546 TSS_2546 TSS_2545 TSS_2545 TSS_2544 TSS_2544 TSS_2543 TSS_2543 TSS_2542 TSS_2542 TSS_2541 TSS_2541 TSS_2540 TSS_2540

Gene      
Name: nuoI    Texpresso search in the literature
Synonym(s): ECK2275, EG12089, b2281
Genome position(nucleotides): 2395908 <-- 2396450 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.33
External database links:  
ASAP:
ABE-0007539
CGSC:
32655
ECHOBASE:
EB2013
MIM:
256000
OU-MICROARRAY:
b2281
PortEco:
nuoI
STRING:
511145.b2281
COLOMBOS: nuoI


Product      
Name: NADH:quinone oxidoreductase subunit I
Synonym(s): NADH:ubiquinone oxidoreductase, chain I, NuoI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.538
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
90 -> 119 EFFRINFSRCIFCGLCEEACPTTAIQLTPD
165 -> 175 EAENEAKPIDV
24 -> 29 AFAKRE
50 -> 80 LTRDPDGEERCVACNLCAVACPVGCISLQKA
59 -> 113 RCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0046872 - metal ion binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0050136 - NADH dehydrogenase (quinone) activity
GO:0048038 - quinone binding
biological_process GO:0009060 - aerobic respiration
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Allison KR., et al., 2011
External database links:  
DIP:
DIP-35918N
ECOCYC:
NUOI-MONOMER
ECOLIWIKI:
b2281
INTERPRO:
IPR017896
INTERPRO:
IPR017900
INTERPRO:
IPR010226
MODBASE:
P0AFD6
PANTHER:
PTHR10849
PFAM:
PF12838
PRIDE:
P0AFD6
PRODB:
PRO_000023436
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_416784
SMR:
P0AFD6
SWISSMODEL:
P0AFD6
UNIPROT:
P0AFD6


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2540 2396044 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2541 2396059 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2542 2396436 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2543 2396485 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2544 2396590 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2545 2396594 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2546 2396596 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2547 2397023 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Allison KR., Brynildsen MP., Collins JJ., 2011, Metabolite-enabled eradication of bacterial persisters by aminoglycosides., Nature 473(7346):216-20

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB