RegulonDB RegulonDB 10.8: Gene Form
   

nuoK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoL nuoM nuoJ nuoI nuoK TSS_2542 TSS_2542 TSS_2541 TSS_2541 TSS_2540 TSS_2540 TSS_2539 TSS_2539 TSS_2538 TSS_2538 TSS_2537 TSS_2537 TSS_2536 TSS_2536 TSS_2535 TSS_2535 TSS_2534 TSS_2534 nuoNp1 nuoNp1

Gene      
Name: nuoK    Texpresso search in the literature
Synonym(s): ECK2273, EG12091, b2279
Genome position(nucleotides): 2395043 <-- 2395345 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.79
External database links:  
ASAP:
ABE-0007534
CGSC:
32649
ECHOBASE:
EB2015
OU-MICROARRAY:
b2279
PortEco:
nuoK
STRING:
511145.b2279
COLOMBOS: nuoK


Product      
Name: NADH:quinone oxidoreductase subunit K
Synonym(s): NADH:ubiquinone oxidoreductase, membrane subunit K, NuoK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 10.845
Isoelectric point: 9.18
Motif(s):
 
Type Positions Sequence
67 -> 67 S
28 -> 48 LLFMLIGLEIMINASALAFVV
8 -> 95 LILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSV
25 -> 26 RR
72 -> 72 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0005515 - protein binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0050136 - NADH dehydrogenase (quinone) activity
GO:0048038 - quinone binding
biological_process GO:0042773 - ATP synthesis coupled electron transport
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-51165N
ECOCYC:
NUOK-MONOMER
ECOLIWIKI:
b2279
INTERPRO:
IPR039428
INTERPRO:
IPR001133
PANTHER:
PTHR11434
PFAM:
PF00420
PRIDE:
P0AFE4
PRODB:
PRO_000023438
REFSEQ:
NP_416782
SMR:
P0AFE4
UNIPROT:
P0AFE4


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nuoNp1 2391717 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2534 2393605 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2535 2393635 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2536 2393749 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2537 2394474 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2538 2394595 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2539 2394680 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2540 2396044 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2541 2396059 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2542 2396436 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB