RegulonDB RegulonDB 10.8: Gene Form
   

sgrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sgrR sgrS sgrT sroA SgrR Cra DksA DksA ppGpp ppGpp Cis-reg; riboswitch terminator anti-terminator anti-anti-terminator sgrSp sgrSp sgrRp sgrRp sroAp sroAp

Gene      
Name: sgrR    Texpresso search in the literature
Synonym(s): ECK0070, EG12094, b0069, yabN
Genome position(nucleotides): 75644 <-- 77299 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.89
External database links:  
ASAP:
ABE-0000251
ECHOBASE:
EB2018
OU-MICROARRAY:
b0069
PortEco:
sgrR
STRING:
511145.b0069
COLOMBOS: sgrR


Product      
Name: DNA-binding transcriptional dual regulator SgrR
Synonym(s): SgrR, YabN
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MarR
Cellular location: periplasmic space,cytosol
Molecular weight: 63.975
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
5 -> 118 RLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLNTMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVRQMLVSHLGRSFRQG
165 -> 306 EADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVSPTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQLKIQAFDDFFGYRALIDEVNVWVLPE
26 -> 49 LNELAALLSCSRRHMRTLLNTMQD
1 -> 116 MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLNTMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVRQMLVSHLGRSFR
163 -> 492 ELEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVSPTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQLKIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLFDSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTIKSEKPAGLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLKIKEIDYDQWHTGEIESDIWLNSANFTLPLDFSVFAHLCEVPLLQHCIPIDWQADAARW

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0003677 - DNA binding
GO:0000984 - bacterial-type RNA polymerase regulatory region sequence-specific DNA binding
GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0015833 - peptide transport
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Vanderpool CK., et al., 2004
External database links:  
ECOCYC:
EG12094-MONOMER
ECOLIWIKI:
b0069
INTERPRO:
IPR000914
INTERPRO:
IPR039424
INTERPRO:
IPR025370
INTERPRO:
IPR023767
MODBASE:
P33595
PANTHER:
PTHR30290
PFAM:
PF00496
PFAM:
PF12793
PRIDE:
P33595
PRODB:
PRO_000023946
PROSITE:
PS50995
PROSITE:
PS01117
REFSEQ:
NP_414611
SMR:
P33595
UNIPROT:
P33595


Operon      
Name: sgrR-sroA-thiBPQ         
Operon arrangement:
Transcription unit        Promoter
sroA
sgrR-sroA-thiBPQ


Transcriptional Regulation      
Display Regulation             
Repressed by: SgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Vanderpool CK., Gottesman S., 2004, Involvement of a novel transcriptional activator and small RNA in post-transcriptional regulation of the glucose phosphoenolpyruvate phosphotransferase system., Mol Microbiol 54(4):1076-89


RegulonDB