RegulonDB RegulonDB 10.8: Gene Form
   

norR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

norR norV gutQ srlR norW IHF IHF NarP NarL NarP NarL NorR NorR NorR FNR NsrR terminator norVp norVp norRp norRp TSS_3019 TSS_3019 TSS_3018 (cluster) TSS_3018 (cluster)

Gene      
Name: norR    Texpresso search in the literature
Synonym(s): ECK2704, EG12108, b2709, ygaA
Genome position(nucleotides): 2830775 <-- 2832289 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.83
External database links:  
ASAP:
ABE-0008904
ECHOBASE:
EB2032
OU-MICROARRAY:
b2709
PortEco:
norR
STRING:
511145.b2709
COLOMBOS: norR


Product      
Name: DNA-binding transcriptional dual regulator NorR
Synonym(s): NorR, YgaA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 55.236
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
479 -> 498 WAACARMLETDVANLHRLAK
187 -> 353 MIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLLRVLQYGDIQRVGDDRCLRVDVRVLAATNRDLREEVLAGRFRADLFHRLSVFPL
278 -> 287 ADNGTLFLDE
23 -> 154 DRFQRLITTLRQVLECDASALLRYDSRQFIPLAIDGLAKDVLGRRFALEGHPRLEAIARAGDVVRFPADSELPDPYDGLIPGQESLKVHACVGLPLFAGQNLIGALTLDGMQPDQFDVFSDEELRLIAALAA
215 -> 222 GETGTGKE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008134 - transcription factor binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008198 - ferrous iron binding
GO:0042802 - identical protein binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0070026 - nitric oxide binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IDA] Inferred from direct assay
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] D'Autreaux B., et al., 2005
[2] Gardner AM., et al., 2003
[3] Gardner AM., et al., 2002
[4] Hutchings MI., et al., 2002
[5] Mukhopadhyay P., et al., 2004
[6] Ramseier TM., et al., 1994
[7] Tucker NP., et al., 2004
External database links:  
DIP:
DIP-12092N
ECOCYC:
EG12108-MONOMER
ECOLIWIKI:
b2709
INTERPRO:
IPR025944
INTERPRO:
IPR029016
INTERPRO:
IPR027417
INTERPRO:
IPR025943
INTERPRO:
IPR025662
INTERPRO:
IPR023944
INTERPRO:
IPR009057
INTERPRO:
IPR003593
INTERPRO:
IPR003018
INTERPRO:
IPR002078
MODBASE:
P37013
PFAM:
PF01590
PFAM:
PF00158
PRIDE:
P37013
PRODB:
PRO_000023398
PROSITE:
PS50045
PROSITE:
PS00688
PROSITE:
PS00676
PROSITE:
PS00675
REFSEQ:
NP_417189
SMART:
SM00065
SMART:
SM00382
SMR:
P37013
SWISSMODEL:
P37013
UNIPROT:
P37013


Operon      
Name: norR         
Operon arrangement:
Transcription unit        Promoter
norR
norR


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR, NorR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3018 (cluster) 2829709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_3019 2829746 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] D'Autreaux B., Tucker NP., Dixon R., Spiro S., 2005, A non-haem iron centre in the transcription factor NorR senses nitric oxide., Nature 437(7059):769-72

 [2] Gardner AM., Gessner CR., Gardner PR., 2003, Regulation of the nitric oxide reduction operon (norRVW) in Escherichia coli. Role of NorR and sigma54 in the nitric oxide stress response., J Biol Chem 278(12):10081-6

 [3] Gardner AM., Helmick RA., Gardner PR., 2002, Flavorubredoxin, an inducible catalyst for nitric oxide reduction and detoxification in Escherichia coli., J Biol Chem 277(10):8172-7

 [4] Hutchings MI., Mandhana N., Spiro S., 2002, The NorR protein of Escherichia coli activates expression of the flavorubredoxin gene norV in response to reactive nitrogen species., J Bacteriol 184(16):4640-3

 [5] Mukhopadhyay P., Zheng M., Bedzyk LA., LaRossa RA., Storz G., 2004, Prominent roles of the NorR and Fur regulators in the Escherichia coli transcriptional response to reactive nitrogen species., Proc Natl Acad Sci U S A 101(3):745-50

 [6] Ramseier TM., Figge RM., Saier MH., 1994, DNA sequence of a gene in Escherichia coli encoding a putative tripartite transcription factor with receiver, ATPase and DNA binding domains., DNA Seq 5(1):17-24

 [7] Tucker NP., D'Autr?aux B., Studholme DJ., Spiro S., Dixon R., 2004, DNA binding activity of the Escherichia coli nitric oxide sensor NorR suggests a conserved target sequence in diverse proteobacteria., J Bacteriol 186(19):6656-60

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB