RegulonDB RegulonDB 10.7: Gene Form
   

acrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mscK acrA acrR SoxS MarA EnvR AcrR MprA PhoP anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_631 TSS_631 TSS_630 TSS_630 TSS_629 TSS_629 kefAp kefAp TSS_628 TSS_628 TSS_627 TSS_627 TSS_626 (cluster) TSS_626 (cluster) TSS_625 TSS_625 acrRp acrRp acrAp acrAp TSS_624 TSS_624 TSS_623 (cluster) TSS_623 (cluster) acrBp acrBp

Gene      
Name: acrR    Texpresso search in the literature
Synonym(s): ECK0458, EG12116, b0464, ybaH
Genome position(nucleotides): 485761 --> 486408 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.37
External database links:  
ASAP:
ABE-0001608
CGSC:
35809
ECHOBASE:
EB2039
OU-MICROARRAY:
b0464
PORTECO:
acrR
REGULONDB:
b0464
STRING:
511145.b0464
M3D: acrR
COLOMBOS: acrR
PortEco: b0464


Product      
Name: DNA-binding transcriptional repressor AcrR
Synonym(s): AcrR, YbaH
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 24.767
Isoelectric point: 5.703
Motif(s):
 
Type Positions Sequence
16 -> 62 ILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEI
29 -> 29 V
33 -> 52 SLGEIAKAAGVTRGAIYWHF
84 -> 202 DPLSVLREILIHVLESTVTEERRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRAAIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMY
10 -> 70 QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESNI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0008144 - drug binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0042493 - response to drug
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Ma D., et al., 1996
External database links:  
ECOCYC:
EG12116-MONOMER
ECOLIWIKI:
b0464
INTERPRO:
IPR009057
INTERPRO:
IPR013572
INTERPRO:
IPR001647
INTERPRO:
IPR036271
INTERPRO:
IPR023772
MODBASE:
P0ACS9
PANTHER:
PTHR30328
PDB:
3BCG
PDB:
2QOP
PFAM:
PF08361
PFAM:
PF00440
PRIDE:
P0ACS9
PRINTS:
PR00455
PRODB:
PRO_000022051
PROSITE:
PS50977
PROSITE:
PS01081
PROTEINMODELPORTAL:
P0ACS9
REFSEQ:
NP_414997
SMR:
P0ACS9
SWISSMODEL:
P0ACS9
UNIPROT:
P0ACS9


Operon      
Name: acrR         
Operon arrangement:
Transcription unit        Promoter
acrR


Transcriptional Regulation      
Display Regulation             
Repressed by: AcrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_623 (cluster) 485648 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_624 485663 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_625 485716 forward nd [RS-EPT-CBR] [2]
  promoter TSS_626 (cluster) 485980 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_627 486041 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_628 486086 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_629 487911 forward nd [RS-EPT-CBR] [2]
  promoter TSS_630 488317 forward nd [RS-EPT-CBR] [2]
  promoter TSS_631 489636 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ma D., Alberti M., Lynch C., Nikaido H., Hearst JE., 1996, The local repressor AcrR plays a modulating role in the regulation of acrAB genes of Escherichia coli by global stress signals., Mol Microbiol 19(1):101-12

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB