RegulonDB RegulonDB 10.7: Gene Form
   

ompX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgE ompX yliM MicA CyaR ompXp2 ompXp2

Gene      
Name: ompX    Texpresso search in the literature
Synonym(s): ECK0803, EG12117, b0814, ompP, ybiG
Genome position(nucleotides): 850450 --> 850965 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0002784
ECHOBASE:
EB2056
OU-MICROARRAY:
b0814
PORTECO:
ompX
REGULONDB:
b0814
STRING:
511145.b0814
M3D: ompX
COLOMBOS: ompX
PortEco: b0814


Product      
Name: outer membrane protein X
Synonym(s): OmpP, OmpX, YbiG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 18.603
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
1 -> 23 MKKIACLSALAAVLAFTAGTSVA
60 -> 69 LGVIGSFTYT
24 -> 171 ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
161 -> 170 GTWIAGVGYR
9 -> 171 ALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0044384 - host outer membrane
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48016N
ECOCYC:
EG12117-MONOMER
ECOLIWIKI:
b0814
INTERPRO:
IPR011250
INTERPRO:
IPR000758
INTERPRO:
IPR027385
MINT:
P0A917
MODBASE:
P0A917
PDB:
2MNH
PDB:
2M07
PDB:
2M06
PDB:
1QJ9
PDB:
1QJ8
PDB:
1Q9G
PDB:
1Q9F
PDB:
1ORM
PFAM:
PF13505
PRIDE:
P0A917
PRINTS:
PR00316
PRODB:
PRO_000023460
PROSITE:
PS00694
PROSITE:
PS00695
PROTEINMODELPORTAL:
P0A917
REFSEQ:
NP_415335
SMR:
P0A917
UNIPROT:
P0A917


Operon      
Name: yliM-ompX         
Operon arrangement:
Transcription unit        Promoter
yliM-ompX
ompX


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR


Regulation by small RNA    
  Display Regulation
small RNA cyaR, micA, omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB