RegulonDB RegulonDB 10.8: Gene Form
   

ychJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rssA purU ychJ Fis ychJp ychJp TSS_1560 TSS_1560 rssAp rssAp purUp4 purUp4 purUp5 purUp5 purUp3 purUp3 TSS_1557 TSS_1557 TSS_1556 TSS_1556

Gene      
Name: ychJ    Texpresso search in the literature
Synonym(s): ECK1228, EG12119, b1233
Genome position(nucleotides): 1288674 <-- 1289132 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.41
External database links:  
ASAP:
ABE-0004140
ECHOBASE:
EB2040
OU-MICROARRAY:
b1233
PortEco:
ychJ
STRING:
511145.b1233
COLOMBOS: ychJ


Product      
Name: NTF2-like domain-containing protein YchJ
Synonym(s): YchJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.99
Isoelectric point: 7.293
Motif(s):
 
Type Positions Sequence
34 -> 35 MR
59 -> 61 AAA
1 -> 19 MSQLCPCGSAVEYSLCCHP
29 -> 127 DPEHLMRSRYCAFVMQDADYLIKTWHPSCGAAALRAELMAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENGQWYYIDG
134 -> 152 RNDPCPCGSGKKFKKCCGQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11572N
ECOCYC:
EG12119-MONOMER
ECOLIWIKI:
b1233
INTERPRO:
IPR023006
INTERPRO:
IPR004027
INTERPRO:
IPR032710
MINT:
MINT-1254950
PFAM:
PF02810
PRIDE:
P37052
REFSEQ:
NP_415749
SMR:
P37052
UNIPROT:
P37052


Operon      
Name: ychJ         
Operon arrangement:
Transcription unit        Promoter
ychJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1556 1288063 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1557 1288077 reverse nd [RS-EPT-CBR] [1]
  promoter purUp3 1288751 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter purUp5 1288753 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter purUp4 1288756 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1560 1289150 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB