RegulonDB RegulonDB 10.6.3: Gene Form
   

hisJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisJ argT hisQ hisM ArgR ArgR hisJp hisJp TSS_2618 TSS_2618

Gene      
Name: hisJ    Texpresso search in the literature
Synonym(s): ECK2303, EG12124, b2309
Genome position(nucleotides): 2426006 <-- 2426788 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.79
External database links:  
ASAP:
ABE-0007617
CGSC:
627
ECHOBASE:
EB2045
ECOCYC:
EG12124
ECOLIHUB:
hisJ
OU-MICROARRAY:
b2309
REGULONDB:
b2309
STRING:
511145.b2309
M3D: hisJ
COLOMBOS: hisJ
PortEco: b2309


Product      
Name: histidine ABC transporter periplasmic binding protein
Synonym(s): HisJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 28.483
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
23 -> 260 AIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG
21 -> 21 F
215 -> 218 VGTG
112 -> 214 ADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFG
219 -> 260 MGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016597 - amino acid binding
biological_process GO:0006865 - amino acid transport
GO:0071705 - nitrogen compound transport
GO:1902024 - L-histidine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Chu BC., et al., 2013
[2] Igarashi S., et al., 2010
External database links:  
DIP:
DIP-9908N
ECOCYC:
HISJ-MONOMER
ECOLIWIKI:
b2309
INTERPRO:
IPR005768
INTERPRO:
IPR018313
INTERPRO:
IPR001638
MODBASE:
P0AEU0
PDB:
1HSL
PFAM:
PF00497
PRIDE:
P0AEU0
PRODB:
PRO_000022899
PROSITE:
PS01039
PROTEINMODELPORTAL:
P0AEU0
REFSEQ:
NP_416812
SMART:
SM00062
SMR:
P0AEU0
SWISSMODEL:
P0AEU0
UNIPROT:
P0AEU0


Operon      
Name: argT-hisJQMP         
Operon arrangement:
Transcription unit        Promoter
hisJQMP
argT-hisJQMP


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, NtrC
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2618 2426821 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chu BC., DeWolf T., Vogel HJ., 2013, Role of the two structural domains from the periplasmic Escherichia coli histidine-binding protein HisJ., J Biol Chem 288(44):31409-22

 [2] Igarashi S., Osawa M., Ozawa S., Shimada I., 2010, Backbone resonance assignments for the ligand binding subunit of the histidine permease complex (HisJ) from Escherichia coli, under histidine-bound and unbound states., Biomol NMR Assign 4(1):17-20

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB