RegulonDB RegulonDB 10.8: Gene Form
   

hscB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscA hscB iscA anti-anti-terminator anti-terminator terminator hscBp hscBp TSS_2826 TSS_2826 TSS_2825 TSS_2825

Gene      
Name: hscB    Texpresso search in the literature
Synonym(s): ECK2524, EG12131, b2527, yfhE
Genome position(nucleotides): 2658952 <-- 2659467 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.33
External database links:  
ASAP:
ABE-0008317
ECHOBASE:
EB2052
OU-MICROARRAY:
b2527
PortEco:
hscB
STRING:
511145.b2527
COLOMBOS: hscB


Product      
Name: [Fe-S] cluster biosynthesis co-chaperone HscB
Synonym(s): Hsc20, Hsc20 co-chaperone that acts with Hsc66 in IscU iron-sulfur cluster assembly, HscB, YfhE, co-chaperone for [Fe-S] cluster biosynthesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.138
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
2 -> 74 DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTLRHPLMRAEYLLSL
88 -> 160 DTAFLMEQLELREELDEIEQAKDEARLESFIKRVKKMFDTRHQLMVEQLDNETWDAAADTVRKLRFLDKLRSS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:1990230 - iron-sulfur cluster transfer complex
molecular_function GO:0005515 - protein binding
GO:0051087 - chaperone binding
GO:0001671 - ATPase activator activity
biological_process GO:0006457 - protein folding
GO:0051259 - protein complex oligomerization
GO:0032781 - positive regulation of ATPase activity
GO:0097428 - protein maturation by iron-sulfur cluster transfer
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Fuzery AK., et al., 2008
[2] Hoff KG., et al., 2003
[3] Hoff KG., et al., 2000
[4] Hoff KG., et al., 2002
[5] Takahashi Y., et al., 1999
[6] Tokumoto U., et al., 2004
[7] Tokumoto U., et al., 2001
External database links:  
DIP:
DIP-47847N
ECOCYC:
EG12131-MONOMER
ECOLIWIKI:
b2527
INTERPRO:
IPR001623
INTERPRO:
IPR036869
INTERPRO:
IPR036386
INTERPRO:
IPR009073
INTERPRO:
IPR004640
MODBASE:
P0A6L9
PANTHER:
PTHR14021
PDB:
1FPO
PFAM:
PF07743
PRIDE:
P0A6L9
PRODB:
PRO_000022926
PROSITE:
PS50076
REFSEQ:
NP_417022
SMART:
SM00271
SMR:
P0A6L9
UNIPROT:
P0A6L9


Operon      
Name: hscBA-fdx-iscX         
Operon arrangement:
Transcription unit        Promoter
hscBA-fdx-iscX


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2825 2658287 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2826 2658293 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Fuzery AK., Tonelli M., Ta DT., Cornilescu G., Vickery LE., Markley JL., 2008, Solution structure of the iron-sulfur cluster cochaperone HscB and its binding surface for the iron-sulfur assembly scaffold protein IscU., Biochemistry 47(36):9394-404

 [2] Hoff KG., Cupp-Vickery JR., Vickery LE., 2003, Contributions of the LPPVK motif of the iron-sulfur template protein IscU to interactions with the Hsc66-Hsc20 chaperone system., J Biol Chem 278(39):37582-9

 [3] Hoff KG., Silberg JJ., Vickery LE., 2000, Interaction of the iron-sulfur cluster assembly protein IscU with the Hsc66/Hsc20 molecular chaperone system of Escherichia coli., Proc Natl Acad Sci U S A 97(14):7790-5

 [4] Hoff KG., Ta DT., Tapley TL., Silberg JJ., Vickery LE., 2002, Hsc66 substrate specificity is directed toward a discrete region of the iron-sulfur cluster template protein IscU., J Biol Chem 277(30):27353-9

 [5] Takahashi Y., Nakamura M., 1999, Functional assignment of the ORF2-iscS-iscU-iscA-hscB-hscA-fdx-ORF3 gene cluster involved in the assembly of Fe-S clusters in Escherichia coli., J Biochem 126(5):917-26

 [6] Tokumoto U., Kitamura S., Fukuyama K., Takahashi Y., 2004, Interchangeability and distinct properties of bacterial Fe-S cluster assembly systems: functional replacement of the isc and suf operons in Escherichia coli with the nifSU-like operon from Helicobacter pylori., J Biochem (Tokyo) 136(2):199-209

 [7] Tokumoto U., Takahashi Y., 2001, Genetic analysis of the isc operon in Escherichia coli involved in the biogenesis of cellular iron-sulfur proteins., J Biochem (Tokyo) 130(1):63-71

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB