RegulonDB RegulonDB 10.9: Gene Form
   

iscA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscB iscU iscA anti-anti-terminator anti-terminator terminator iscAp6 iscAp6 iscAp7 iscAp7 hscBp hscBp

Gene      
Name: iscA    Texpresso search in the literature
Synonym(s): ECK2525, EG12132, b2528, yfhF
Genome position(nucleotides): 2659563 <-- 2659886 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.54
Reference(s): [1] Takahashi Y., et al., 1999
External database links:  
ASAP:
ABE-0008319
ECHOBASE:
EB2053
ECOLIHUB:
iscA
OU-MICROARRAY:
b2528
STRING:
511145.b2528
COLOMBOS: iscA


Product      
Name: iron-sulfur cluster insertion protein IscA
Synonym(s): IscA, YfhF, iron-sulfur cluster assembly protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.556
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
1 -> 103 MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGE
35 -> 35 C
101 -> 101 C
99 -> 99 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005198 - structural molecule activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
GO:0034986 - iron chaperone activity
biological_process GO:0016226 - iron-sulfur cluster assembly
GO:0097428 - protein maturation by iron-sulfur cluster transfer
External database links:  
DIP:
DIP-35854N
ECOCYC:
EG12132-MONOMER
ECOLIWIKI:
b2528
INTERPRO:
IPR035903
INTERPRO:
IPR017870
INTERPRO:
IPR016092
INTERPRO:
IPR000361
INTERPRO:
IPR011302
MODBASE:
P0AAC8
PDB:
1S98
PDB:
1R95
PDB:
1R94
PFAM:
PF01521
PRIDE:
P0AAC8
PRODB:
PRO_000023031
PROSITE:
PS01152
REFSEQ:
NP_417023
SMR:
P0AAC8
UNIPROT:
P0AAC8


Operon      
Name: iscRSUA         
Operon arrangement:
Transcription unit        Promoter
iscRSUA


Transcriptional Regulation      
Display Regulation             
Repressed by: IscR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter iscAp7 2659953 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter iscAp6 2659962 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Takahashi Y., Nakamura M., 1999, Functional assignment of the ORF2-iscS-iscU-iscA-hscB-hscA-fdx-ORF3 gene cluster involved in the assembly of Fe-S clusters in Escherichia coli., J Biochem 126(5):917-26

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB