RegulonDB RegulonDB 10.7: Gene Form
   

rhtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhtA dps yliM IHF OxyR OxyR Fis OxyR MntR Fis H-NS rhtAp8 rhtAp8 TSS_976 TSS_976 TSS_975 TSS_975 TSS_974 TSS_974 yliMp yliMp dpsp dpsp TSS_972 (cluster) TSS_972 (cluster) TSS_971 TSS_971

Gene      
Name: rhtA    Texpresso search in the literature
Synonym(s): ECK0802, EG12134, b0813, ybiF
Genome position(nucleotides): 849210 <-- 850097 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.49
External database links:  
ASAP:
ABE-0002779
ECHOBASE:
EB2055
OU-MICROARRAY:
b0813
PORTECO:
rhtA
REGULONDB:
b0813
STRING:
511145.b0813
M3D: rhtA
COLOMBOS: rhtA
PortEco: b0813


Product      
Name: L-threonine/L-homoserine exporter
Synonym(s): RhtA, YbiF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.168
Isoelectric point: 9.765
Motif(s):
 
Type Positions Sequence
148 -> 277 TGCALALGAGACWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASM
238 -> 258 FGTLMSMEPALAAVSGMIFLG
94 -> 114 TVPLGIAVALEFTGPLAVALF
10 -> 30 VWLPIVILLVAMASIQGGASL
39 -> 59 GAPGVTALRLALGTLILIAFF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015291 - secondary active transmembrane transporter activity
GO:0042970 - homoserine transmembrane transporter activity
GO:0015565 - threonine efflux transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0015826 - threonine transport
GO:0042968 - homoserine transport
Note(s): Note(s): ...[more].
Reference(s): [1] DeLisa MP., et al., 2001
[2] Diesveld R., et al., 2008
[3] Jindal S., et al., 2019
[4] Jones CM., et al., 2015
[5] Kang Z., et al., 2011
[6] Livshits VA., et al., 2003
[7] Xu Y., et al., 2017
[8] Zakataeva NP., et al., 2006
External database links:  
ECOCYC:
EG12134-MONOMER
ECOLIWIKI:
b0813
INTERPRO:
IPR000620
PFAM:
PF00892
PRIDE:
P0AA67
PRODB:
PRO_000023747
PROTEINMODELPORTAL:
P0AA67
REFSEQ:
NP_415334
UNIPROT:
P0AA67


Operon      
Name: rhtA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_971 848936 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_972 (cluster) 848945 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_974 850211 forward nd [RS-EPT-CBR] [9]
  promoter TSS_975 850213 forward nd [RS-EPT-CBR] [9]
  promoter TSS_976 850222 forward nd [RS-EPT-CBR] [9]
  promoter rhtAp8 850304 reverse Similarity to the consensus
Read more >
[ICWHO] [10]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] DeLisa MP., Wu CF., Wang L., Valdes JJ., Bentley WE., 2001, DNA microarray-based identification of genes controlled by autoinducer 2-stimulated quorum sensing in Escherichia coli., J Bacteriol 183(18):5239-47

 [2] Diesveld R., Tietze N., Furst O., Reth A., Bathe B., Sahm H., Eggeling L., 2008, Activity of Exporters of Escherichia coli in Corynebacterium glutamicum, and Their Use to Increase L-Threonine Production., J Mol Microbiol Biotechnol NIL

 [3] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [4] Jones CM., Hernandez Lozada NJ., Pfleger BF., 2015, Efflux systems in bacteria and their metabolic engineering applications., Appl Microbiol Biotechnol 99(22):9381-93

 [5] Kang Z., Wang Y., Gu P., Wang Q., Qi Q., 2011, Engineering Escherichia coli for efficient production of 5-aminolevulinic acid from glucose., Metab Eng 13(5):492-8

 [6] Livshits VA., Zakataeva NP., Aleshin VV., Vitushkina MV., 2003, Identification and characterization of the new gene rhtA involved in threonine and homoserine efflux in Escherichia coli., Res Microbiol 154(2):123-35

 [7] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [8] Zakataeva NP., Kutukova EA., Gronskii SV., Troshin PV., Livshits VA., Aleshin VV., 2006, [Export of metabolites by the proteins of the DMT and RhtB families and its possible role in intercellular communication], Mikrobiologiia 75(4):509-20

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB