RegulonDB RegulonDB 10.8: Gene Form
   

nlpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaeF nlpE arfB yaeQ TSS_396 TSS_396

Gene      
Name: nlpE    Texpresso search in the literature
Synonym(s): ECK0192, EG12137, b0192, cutF
Genome position(nucleotides): 215269 --> 215979 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.32
External database links:  
ASAP:
ABE-0000652
CGSC:
35748
ECHOBASE:
EB2058
OU-MICROARRAY:
b0192
PortEco:
nlpE
STRING:
511145.b0192
COLOMBOS: nlpE


Product      
Name: sensor lipoprotein NlpE
Synonym(s): CutF, NlpE, outer membrane lipoprotein NlpE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane
Molecular weight: 25.844
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
126 -> 236 PIESQFNYTLEAAQSSLPMTPMTLRGMYFYMADAATFTDCATGKRFMVANNAELERSYLAARGHSEKPVLLSVEGHFTLEGNPDTGAPTKVLAPDTAGKFYPNQDCSSLGQ
45 -> 129 WRGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSKGEKSYYRAKGDALEMLDREGNPIES
1 -> 20 MVKKAIVTAMAVISLFTLMG
165 -> 165 C
22 -> 23 NN

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0010810 - regulation of cell-substrate adhesion
GO:1990169 - stress response to copper ion
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
Reference(s): [1] Delhaye A., et al., 2019
[2] Grabowicz M., et al., 2017
[3] Gupta SD., et al., 1995
[4] Mileykovskaya E., et al., 1997
[5] Nishino K., et al., 2010
External database links:  
DIP:
DIP-9353N
ECOCYC:
EG12137-MONOMER
ECOLIWIKI:
b0192
INTERPRO:
IPR007298
INTERPRO:
IPR033450
INTERPRO:
IPR038139
PDB:
2Z4I
PDB:
2Z4H
PFAM:
PF04170
PFAM:
PF17185
PRIDE:
P40710
PRODB:
PRO_000023395
PROSITE:
PS51257
REFSEQ:
NP_414734
SMR:
P40710
UNIPROT:
P40710


Operon      
Name: yaeQ-arfB-nlpE         
Operon arrangement:
Transcription unit        Promoter
yaeQ-arfB-nlpE


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_396 215265 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Delhaye A., Laloux G., Collet JF., 2019, The Lipoprotein NlpE Is a Cpx Sensor That Serves as a Sentinel for Protein Sorting and Folding Defects in the Escherichia coli Envelope., J Bacteriol 201(10)

 [2] Grabowicz M., Silhavy TJ., 2017, Redefining the essential trafficking pathway for outer membrane lipoproteins., Proc Natl Acad Sci U S A 114(18):4769-4774

 [3] Gupta SD., Lee BT., Camakaris J., Wu HC., 1995, Identification of cutC and cutF (nlpE) genes involved in copper tolerance in Escherichia coli., J Bacteriol 177(15):4207-15

 [4] Mileykovskaya E., Dowhan W., 1997, The Cpx two-component signal transduction pathway is activated in Escherichia coli mutant strains lacking phosphatidylethanolamine., J Bacteriol 179(4):1029-34

 [5] Nishino K., Yamasaki S., Hayashi-Nishino M., Yamaguchi A., 2010, Effect of NlpE overproduction on multidrug resistance in Escherichia coli., Antimicrob Agents Chemother 54(5):2239-43

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB