RegulonDB RegulonDB 10.8: Gene Form
   

yaeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proS yaeF nlpE terminator yaeFp1 yaeFp1

Gene      
Name: yaeF    Texpresso search in the literature
Synonym(s): ECK0193, EG12138, b0193, yaeK
Genome position(nucleotides): 216179 <-- 217003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.33
External database links:  
ASAP:
ABE-0000655
ECHOBASE:
EB2059
OU-MICROARRAY:
b0193
PortEco:
yaeF
STRING:
511145.b0193
COLOMBOS: yaeF


Product      
Name: peptidase C92 family protein YaeF
Synonym(s): YaeF, YaeK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 29.912
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
1 -> 20 MDKPKAYCRLFLPSFLLLSA
21 -> 274 CTVDISQPDPSATAVDAEAKTWAVKFQHQSSFTEQSIKEITAPDLKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIFLGDNNVAEATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATDITAFANKIKDSGYNYRGIVEFIPFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVGEGDKKSWFCSEFVTDAFAKAGHPLTLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR
65 -> 156 LKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIFLGDNNVAEATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATDITAFANKIKDSGYNY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008234 - cysteine-type peptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Serres MH., et al., 2001
External database links:  
ECOCYC:
EG12138-MONOMER
ECOLIWIKI:
b0193
INTERPRO:
IPR038765
INTERPRO:
IPR024453
PFAM:
PF05708
PRIDE:
P37056
PROSITE:
PS51257
REFSEQ:
NP_414735
SMR:
P37056
UNIPROT:
P37056


Operon      
Name: yaeF         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeFp1 217135 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB