RegulonDB RegulonDB 10.7: Gene Form
   

pgm gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgm seqA ybfP terminator anti-terminator anti-anti-terminator TSS_826 TSS_826 TSS_825 TSS_825

Gene      
Name: pgm    Texpresso search in the literature
Synonym(s): ECK0676, EG12144, b0688, blu
Genome position(nucleotides): 713558 --> 715198 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.27
External database links:  
ASAP:
ABE-0002345
CGSC:
406
ECHOBASE:
EB2065
OU-MICROARRAY:
b0688
PORTECO:
pgm
REGULONDB:
b0688
STRING:
511145.b0688
M3D: pgm
COLOMBOS: pgm
PortEco: b0688


Product      
Name: phosphoglucomutase
Synonym(s): Blu, Pgm
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 58.361
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
146 -> 147 SH
308 -> 309 DR
40 -> 179 VKFGTSGHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEDRANA
320 -> 440 NPNHYLAVAINYLFQHRPQWGKDVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAKRF
482 -> 538 LTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGEEHRKQIEKEAVEI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0004614 - phosphoglucomutase activity
GO:0016868 - intramolecular transferase activity, phosphotransferases
GO:0000287 - magnesium ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006006 - glucose metabolic process
GO:0005978 - glycogen biosynthetic process
GO:0019388 - galactose catabolic process
GO:0071704 - organic substance metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10472N
ECOCYC:
PHOSPHOGLUCMUT-MONOMER
ECOLIWIKI:
b0688
INTERPRO:
IPR036900
INTERPRO:
IPR005843
INTERPRO:
IPR016066
INTERPRO:
IPR005844
INTERPRO:
IPR005845
INTERPRO:
IPR005846
INTERPRO:
IPR005852
INTERPRO:
IPR016055
MINT:
MINT-1240111
MODBASE:
P36938
PFAM:
PF00408
PFAM:
PF02880
PFAM:
PF02879
PFAM:
PF02878
PRIDE:
P36938
PRODB:
PRO_000023524
PROSITE:
PS00710
PROTEINMODELPORTAL:
P36938
REFSEQ:
NP_415214
SMR:
P36938
SWISSMODEL:
P36938
UNIPROT:
P36938


Operon      
Name: seqA-pgm         
Operon arrangement:
Transcription unit        Promoter
seqA-pgm


Transcriptional Regulation      
Display Regulation             
Repressed by: HU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_825 713180 forward nd [RS-EPT-CBR] [1]
  promoter TSS_826 713441 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB