RegulonDB RegulonDB 10.7: Gene Form
   

idnK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

idnD ahr idnK GntR CRP IdnR GntR GntR CRP terminator anti-terminator anti-anti-terminator idnKp idnKp idnDp idnDp

Gene      
Name: idnK    Texpresso search in the literature
Synonym(s): ECK4261, EG12152, b4268, gntV
Genome position(nucleotides): 4494623 --> 4495186 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.44
External database links:  
ASAP:
ABE-0013980
CGSC:
17686
ECHOBASE:
EB2072
OU-MICROARRAY:
b4268
PORTECO:
idnK
REGULONDB:
b4268
STRING:
511145.b4268
M3D: idnK
COLOMBOS: idnK
PortEco: b4268


Product      
Name: D-gluconate kinase, thermosensitive
Synonym(s): GntV, IdnK, gluconokinase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.004
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
10 -> 17 GVSGSGKT
12 -> 162 SGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPWLERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRAGHFMPVALLKSQFEALERPQADEQDIVRIDINHDIANVTEQC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0046316 - gluconokinase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016310 - phosphorylation
GO:0046183 - L-idonate catabolic process
GO:0019521 - D-gluconate metabolic process
GO:0046177 - D-gluconate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Gomez KM., et al., 2011
[2] Isturiz T., et al., 1997
[3] Wang IN., et al., 2001
External database links:  
ECOCYC:
GLUCONOKINI-MONOMER
ECOLIWIKI:
b4268
INTERPRO:
IPR031322
INTERPRO:
IPR027417
INTERPRO:
IPR006001
MODBASE:
P39208
PFAM:
PF01202
PRIDE:
P39208
PRODB:
PRO_000022994
PROTEINMODELPORTAL:
P39208
REFSEQ:
NP_418689
SMR:
P39208
SWISSMODEL:
P39208
UNIPROT:
P39208


Operon      
Name: idnK         
Operon arrangement:
Transcription unit        Promoter
idnK


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IdnR
Repressed by: GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gomez KM., Rodriguez A., Rodriguez Y., Ramirez AH., Isturiz T., 2011, The subsidiary GntII system for gluconate metabolism in Escherichia coli: alternative induction of the gntV gene., Biol Res 44(3):269-75

 [2] Isturiz T., Celaya J., 1997, The metabolism of gluconate in Escherichia coli. The subsidiary system and the nature of the gntS gene., J Basic Microbiol 37(2):105-14

 [3] Wang IN., Dykhuizen DE., 2001, Variation of enzyme activities at a branched pathway involved in the utilization of gluconate in Escherichia coli., Evolution 55(5):897-908


RegulonDB