RegulonDB RegulonDB 10.8: Gene Form
   

ppnP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroM ykiA ppnP ykiD RcsB-BglJ TSS_501 TSS_501 ykiAp ykiAp ppnPp ppnPp

Gene      
Name: ppnP    Texpresso search in the literature
Synonym(s): ECK0386, EG12159, b0391, yaiE
Genome position(nucleotides): 408177 --> 408461 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.93
External database links:  
ASAP:
ABE-0001360
ECHOBASE:
EB2079
OU-MICROARRAY:
b0391
PortEco:
yaiE
STRING:
511145.b0391
COLOMBOS: ppnP


Product      
Name: nucleoside phosphorylase PpnP
Synonym(s): PpnP, YaiE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.234
Isoelectric point: 4.177
Motif(s):
 
Type Positions Sequence
77 -> 94 SEFHLQVAEPTSYLCRYL
3 -> 93 QSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0004731 - purine-nucleoside phosphorylase activity
GO:0004850 - uridine phosphorylase activity
GO:0009032 - thymidine phosphorylase activity
GO:0016154 - pyrimidine-nucleoside phosphorylase activity
GO:0047975 - guanosine phosphorylase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12159-MONOMER
ECOLIWIKI:
b0391
INTERPRO:
IPR009664
INTERPRO:
IPR014710
INTERPRO:
IPR011051
PANTHER:
PTHR36540
PFAM:
PF06865
PRIDE:
P0C037
REFSEQ:
NP_414925
SMR:
P0C037
UNIPROT:
P0C037


Operon      
Name: ppnP         
Operon arrangement:
Transcription unit        Promoter
ppnP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_501 408598 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB