RegulonDB RegulonDB 10.8: Gene Form
   

eaeH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eaeH insE1 insEF1 ykgR ykgP insF1 CRP terminator anti-terminator ykgRp ykgRp

Gene      
Name: eaeH    Texpresso search in the literature
Synonym(s): ECK0297, EG12161, b0297
Type: Pseudo Gene
Genome position(nucleotides): 314357 --> 315244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.31
External database links:  
ASAP:
ABE-0001025
ECHOBASE:
EB2080
ECOO157CYC:
EAEH
ECOO157CYC:
Z5932
ECOO157CYC:
EAE
OU-MICROARRAY:
b0297
PortEco:
eaeH
STRING:
316407.85674442
COLOMBOS: eaeH


Product      
Name: putative porin domain-containing protein EaeH
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 8.375
Motif(s):
 
Type Positions Sequence
1 -> 25 MSHYKTGHKQPRFRYSVLARCVAWA
292 -> 295 LTQQ
26 -> 295 NISVQVLFPLAVTFTPVMAARAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKANQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQSNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWKKSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAISAEVTYTPVPLTQQ
48 -> 50 QHA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Evidence: [ICA] Inferred by computational analysis
External database links:  
ECOCYC:
EG12161-MONOMER
ECOLIWIKI:
b0297
ECOO157CYC:
EAEH-MONOMER
ECOO157CYC:
EAE-MONOMER
ECOO157CYC:
Z5932-MONOMER
INTERPRO:
IPR024519
INTERPRO:
IPR003535
INTERPRO:
IPR038177
PFAM:
PF11924
PRIDE:
P36943
PRINTS:
PR01369
REFSEQ:
NP_414831
SMR:
P36943
UNIPROT:
P36943


Operon      
Name: eaeH-insE1EF1F1         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB