RegulonDB RegulonDB 10.7: Gene Form
   

gatR gene in Escherichia coli K-12 genome

Gene      
Name: gatR    Texpresso search in the literature
Synonym(s): ECK2083, EG12162, b2087, b2090, b4498
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.38
External database links:  
ASAP:
ABE-0285099
ASAP:
ABE-0006921
ASAP:
ABE-0006914
CGSC:
32562
OU-MICROARRAY:
b2090
OU-MICROARRAY:
b2087
PORTECO:
gatR_1
PORTECO:
gatR_2
REGULONDB:
b4498
UNIPROT:
P36930
M3D: gatR
COLOMBOS: gatR
PortEco: b2087


Product      
Name: DNA-binding transcriptional repressor GatR, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 7.673
Motif(s):
 
Type Positions Sequence
5 -> 60 ERRNKIIQLVNEQGTVLVQDLAGVFAASEATIRADLRFLEQKGVVTRFHGGAAKIM
103 -> 112 LDSGSTTMLI
22 -> 41 VQDLAGVFAASEATIRADLR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Komoda Y., et al., 1991
[2] Nobelmann B., et al., 1995
[3] Zeng G., et al., 1996
External database links:  
ECOCYC:
PD00338
ECOLIWIKI:
b2090
MODBASE:
P36930
PFAM:
PF08220
PRODB:
PRO_000022757
UNIPROT:
P36930


Operon      
Name: gatR         
Operon arrangement:
Transcription unit        Promoter
gatR_2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Komoda Y., Enomoto M., Tominaga A., 1991, Large inversion in Escherichia coli K-12 1485IN between inversely oriented IS3 elements near lac and cdd., Genetics 129(3):639-45

 [2] Nobelmann B., Lengeler JW., 1995, Sequence of the gat operon for galactitol utilization from a wild-type strain EC3132 of Escherichia coli., Biochim Biophys Acta 1262(1):69-72

 [3] Zeng G., Ye S., Larson TJ., 1996, Repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K-12: primary structure and identification of the DNA-binding domain., J Bacteriol 178(24):7080-9


RegulonDB