RegulonDB RegulonDB 10.6.3: Gene Form
   

mukF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mukB mukF cmoM elyC mukE ycbJ CpxR TSS_1197 TSS_1197 TSS_1196 TSS_1196 TSS_1195 TSS_1195 TSS_1194 TSS_1194 cmoMp cmoMp

Gene      
Name: mukF    Texpresso search in the literature
Synonym(s): ECK0913, EG12165, b0922, kicB
Genome position(nucleotides): 974319 --> 975641 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.83
External database links:  
ASAP:
ABE-0003134
CGSC:
31748
ECHOBASE:
EB2084
ECOCYC:
EG12165
ECOLIHUB:
mukF
OU-MICROARRAY:
b0922
REGULONDB:
b0922
STRING:
511145.b0922
M3D: mukF
COLOMBOS: mukF
PortEco: b0922


Product      
Name: chromosome partitioning protein MukF
Synonym(s): Ca2+-binding protein involved in chromosome partitioning, KicB, MukF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,bacterial nucleoid
Molecular weight: 50.579
Isoelectric point: 4.507
Motif(s):
 
Type Positions Sequence
121 -> 281 STLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV
208 -> 236 LSETSGTLRELQDTLEAAGDKLQANLLRI
283 -> 440 KFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPEDLEYEEFNEIREQLAAIIEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLPAKWQPINDYGAKVQAHVIDKY
3 -> 117 EFSQTVPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQ
233 -> 233 L

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
molecular_function GO:0005515 - protein binding
GO:0005509 - calcium ion binding
biological_process GO:0051301 - cell division
GO:0006260 - DNA replication
GO:0007049 - cell cycle
GO:0007059 - chromosome segregation
GO:0030261 - chromosome condensation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-39981N
ECOCYC:
EG12165-MONOMER
ECOLIWIKI:
b0922
INTERPRO:
IPR038198
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005582
INTERPRO:
IPR033439
INTERPRO:
IPR033440
INTERPRO:
IPR033441
INTERPRO:
IPR036141
MINT:
P60293
PDB:
3RPU
PDB:
3EUH
PDB:
1T98
PFAM:
PF03882
PFAM:
PF17192
PFAM:
PF17193
PRIDE:
P60293
PRODB:
PRO_000023311
PROTEINMODELPORTAL:
P60293
REFSEQ:
NP_415442
SMR:
P60293
UNIPROT:
P60293


Operon      
Name: cmoM-mukFEB         
Operon arrangement:
Transcription unit        Promoter
smtA-mukFEB


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1194 975868 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1195 979917 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1196 980088 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1197 980108 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB