RegulonDB RegulonDB 10.8: Gene Form
   

elyC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycbJ cmoM elyC kdsB ycaR mukF terminator anti-terminator anti-anti-terminator cmoMp cmoMp TSS_1193 TSS_1193 TSS_1192 TSS_1192 ycbJp ycbJp

Gene      
Name: elyC    Texpresso search in the literature
Synonym(s): ECK0911, EG12166, b0920, ycbC
Genome position(nucleotides): 972622 <-- 973401 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.18
External database links:  
ASAP:
ABE-0003127
ECHOBASE:
EB2085
OU-MICROARRAY:
b0920
PortEco:
ycbC
STRING:
511145.b0920
COLOMBOS: elyC


Product      
Name: envelope biogenesis factor
Synonym(s): ElyC, YcbC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.666
Isoelectric point: 9.75
Motif(s):
 
Type Positions Sequence
12 -> 32 MLLPLPLMLLIIGAGLALLWF
89 -> 89 Y
39 -> 59 GKIFISIGWLALLLLSLQPVA
80 -> 213 DYIVVLGGGYTWNPQWAPSSNLINNSLPRLNEGIRLWRENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGVPREQIITLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPAPANQLA
150 -> 170 GVPREQIITLDLPKDTEEEAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0006457 - protein folding
GO:0043164 - Gram-negative-bacterium-type cell wall biogenesis
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Evidence: [IFC] Inferred by functional complementation
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12166-MONOMER
ECOLIWIKI:
b0920
INTERPRO:
IPR003848
PFAM:
PF02698
PRIDE:
P0AB01
REFSEQ:
NP_415440
SMR:
P0AB01
UNIPROT:
P0AB01


Operon      
Name: elyC         
Operon arrangement:
Transcription unit        Promoter
ycbC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1192 971727 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1193 971733 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB