RegulonDB RegulonDB 10.6.3: Gene Form
   

gspM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspL gspK gspO bfr gspM gspJ TSS_3834 TSS_3834

Gene      
Name: gspM    Texpresso search in the literature
Synonym(s): ECK3321, EG12173, b3334, hopZ, pshM
Genome position(nucleotides): 3465082 --> 3465543 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.84
External database links:  
ASAP:
ABE-0010898
ECHOBASE:
EB2091
ECOCYC:
EG12173
ECOLIHUB:
gspM
OU-MICROARRAY:
b3334
REGULONDB:
b3334
STRING:
511145.b3334
M3D: gspM
COLOMBOS: gspM
PortEco: b3334


Product      
Name: Type II secretion system protein GspM
Synonym(s): GspM, HopZ, PshM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.234
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
17 -> 37 VAALAVLSLGVFCWLGVIKPI
2 -> 150 IKSWWAEKSTSEKQIVAALAVLSLGVFCWLGVIKPIDTYIAEHQSHAQKIKKDIKWMQDQASTHGLLGHPALTQPIKNILLEEAKRENLAITLENGPDNTLTIHPVTAPLENVSRWLTTAQVTYGIVIEDLQFTLAGNEEITLRHLSFR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0015031 - protein transport
GO:0009306 - protein secretion
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12173-MONOMER
ECOLIWIKI:
b3334
INTERPRO:
IPR007690
INTERPRO:
IPR023229
PFAM:
PF04612
PRIDE:
P36678
PROTEINMODELPORTAL:
P36678
REFSEQ:
NP_417793
SMR:
P36678
UNIPROT:
P36678


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
null
null
null


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3834 3464173 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB