RegulonDB RegulonDB 10.9: Gene Form
   

cutA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dsbD dcuA yjdC cutA anti-anti-terminator anti-terminator terminator TSS_4939 TSS_4939 TSS_4938 TSS_4938 TSS_4937 TSS_4937 TSS_4936 TSS_4936 TSS_4935 TSS_4935 TSS_4934 TSS_4934 cutAp cutAp TSS_4933 TSS_4933 TSS_4932 TSS_4932 yjdCp yjdCp

Gene      
Name: cutA    Texpresso search in the literature
Synonym(s): ECK4131, EG12177, b4137, cutA1
Genome position(nucleotides): 4365018 <-- 4365356 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.15
External database links:  
ASAP:
ABE-0013544
CGSC:
34216
ECHOBASE:
EB2094
ECOLIHUB:
cutA
OU-MICROARRAY:
b4137
STRING:
511145.b4137
COLOMBOS: cutA


Shine dalgarno      
Sequence: tctgttcttgCGAGGTgttTAT


Product      
Name: copper binding protein CutA
Synonym(s): CutA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.331
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
24 -> 24 A
12 -> 109 VVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005507 - copper ion binding
GO:0046872 - metal ion binding
biological_process GO:0010038 - response to metal ion
GO:0046688 - response to copper ion
External database links:  
DIP:
DIP-47984N
ECOCYC:
EG12177-MONOMER
ECOLIWIKI:
b4137
INTERPRO:
IPR023700
INTERPRO:
IPR004323
INTERPRO:
IPR011322
INTERPRO:
IPR015867
MODBASE:
P69488
PANTHER:
PTHR23419
PDB:
4Y6I
PDB:
4Y65
PDB:
3X3U
PDB:
1NAQ
PDB:
3AA8
PDB:
3AA9
PDB:
3AH6
PFAM:
PF03091
PRIDE:
P69488
PRODB:
PRO_000022355
REFSEQ:
NP_418560
SMR:
P69488
UNIPROT:
P69488


Operon      
Name: cutA         
Operon arrangement:
Transcription unit        Promoter
cutA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4932 4363473 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4933 4364237 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4934 4366101 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4935 4366103 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4936 4366114 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4937 4366119 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4938 4366313 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4939 4366748 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB