RegulonDB RegulonDB 10.9: Gene Form
   

pagP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcuC pagP cspE cspE3\' CRP DinJ-YafQ SlyA PhoP SlyA ArcA SlyA FNR FNR FNR Cis-reg; thermoregulator terminator TSS_751 TSS_751 TSS_750 TSS_750 cspEp2 cspEp2 cspEp1 cspEp1 pagPp pagPp dcuCp dcuCp TSS_749 TSS_749

Gene      
Name: pagP    Texpresso search in the literature
Synonym(s): ECK0615, EG12180, b0622, crcA, ybeG
Genome position(nucleotides): 656557 --> 657117 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.88
External database links:  
ASAP:
ABE-0002139
ECHOBASE:
EB2097
ECOLIHUB:
pagP
OU-MICROARRAY:
b0622
STRING:
511145.b0622
COLOMBOS: pagP


Product      
Name: Lipid A palmitoyltransferase
Synonym(s): CrcA, PagP, YbeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 21.77
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
1 -> 25 MNVSKYVAIFSFVFIQLISVGKVFA
26 -> 186 NADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQF
37 -> 183 NIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMR
102 -> 102 S
113 -> 113 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016416 - O-palmitoyltransferase activity
biological_process GO:0009245 - lipid A biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Burgess NK., et al., 2008
[2] Eguchi Y., et al., 2004
[3] Shuster Y., et al., 2016
[4] Song X., et al., 2019
[5] Zhou Z., et al., 1999
External database links:  
ECOCYC:
EG12180-MONOMER
ECOLIWIKI:
b0622
INTERPRO:
IPR009746
INTERPRO:
IPR011250
MODBASE:
P37001
PDB:
3GP6
PDB:
1THQ
PDB:
1MM5
PDB:
1MM4
PFAM:
PF07017
PRIDE:
P37001
PRODB:
PRO_000022327
REFSEQ:
NP_415155
SMR:
P37001
UNIPROT:
P37001


Operon      
Name: pagP         
Operon arrangement:
Transcription unit        Promoter
pagP


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_749 656023 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_750 657301 forward nd [RS-EPT-CBR] [6]
  promoter TSS_751 657375 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burgess NK., Dao TP., Stanley AM., Fleming KG., 2008, Beta-barrel proteins that reside in the Escherichia coli outer membrane in vivo demonstrate varied folding behavior in vitro., J Biol Chem 283(39):26748-58

 [2] Eguchi Y., Okada T., Minagawa S., Oshima T., Mori H., Yamamoto K., Ishihama A., Utsumi R., 2004, Signal transduction cascade between EvgA/EvgS and PhoP/PhoQ two-component systems of Escherichia coli., J Bacteriol 186(10):3006-14

 [3] Shuster Y., Steiner-Mordoch S., Alon Cudkowicz N., Schuldiner S., 2016, A Transporter Interactome Is Essential for the Acquisition of Antimicrobial Resistance to Antibiotics., PLoS One 11(4):e0152917

 [4] Song X., Hou M., Tu J., Xue M., Shao Y., Jiang H., Liu H., Xue T., Wang G., Qi K., 2019, Outer membrane proteins YbjX and PagP co-regulate motility in Escherichia coli via the bacterial chemotaxis pathway., Res Vet Sci 125:279-284

 [5] Zhou Z., Lin S., Cotter RJ., Raetz CR., 1999, Lipid A modifications characteristic of Salmonella typhimurium are induced by NH4VO3 in Escherichia coli K12. Detection of 4-amino-4-deoxy-L-arabinose, phosphoethanolamine and palmitate., J Biol Chem 274(26):18503-14

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB