RegulonDB RegulonDB 10.7: Gene Form
   

yajG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ampG yajG bolA OmpR ppGpp anti-terminator terminator TSS_561 TSS_561 bolAp1 bolAp1 TSS_559 TSS_559 TSS_558 TSS_558 TSS_557 (cluster) TSS_557 (cluster) bolAp2 bolAp2 yajGp yajGp TSS_555 TSS_555 ampGp4 ampGp4 ampGp6 ampGp6 ampGp5 ampGp5

Gene      
Name: yajG    Texpresso search in the literature
Synonym(s): ECK0428, EG12182, b0434
Genome position(nucleotides): 453589 <-- 454167 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.3
External database links:  
ASAP:
ABE-0001504
ECHOBASE:
EB2099
OU-MICROARRAY:
b0434
PORTECO:
yajG
REGULONDB:
b0434
STRING:
511145.b0434
M3D: yajG
COLOMBOS: yajG
PortEco: b0434


Product      
Name: putative lipoprotein YajG
Synonym(s): YajG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.95
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
18 -> 192 CAKPPTTIEVSPTITLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIKQNAR
29 -> 188 PTITLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIK
3 -> 19 KKILFPLVALFMLAGCA
1 -> 17 MFKKILFPLVALFMLAG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12182-MONOMER
ECOLIWIKI:
b0434
INTERPRO:
IPR012640
INTERPRO:
IPR005619
PFAM:
PF03923
PFAM:
PF08139
PRIDE:
P0ADA5
PROSITE:
PS51257
PROTEINMODELPORTAL:
P0ADA5
REFSEQ:
NP_414968
SMR:
P0ADA5
UNIPROT:
P0ADA5


Operon      
Name: yajG-ampG         
Operon arrangement:
Transcription unit        Promoter
yajG
yajG-ampG
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ampGp5 453627 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ampGp6 453684 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ampGp4 453686 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_555 454207 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_557 (cluster) 454351 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_558 454423 forward nd [RS-EPT-CBR] [2]
  promoter TSS_559 454425 forward nd [RS-EPT-CBR] [2]
  promoter TSS_561 454664 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB