RegulonDB RegulonDB 10.8: Gene Form
   

eutR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutR hemF eutK

Gene      
Name: eutR    Texpresso search in the literature
Synonym(s): ECK2432, EG12190, b2437, yfeG
Genome position(nucleotides): 2554130 <-- 2555182 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
Note(s): By making use of micro arrays analysis it was concluded that anarobiosis do not affect the expression of eutR gene, although FNR appears to repress it. A putative FNR binding site, which is not shown in the paper, was identified upstream of this gene Salmon K,2003.
External database links:  
ASAP:
ABE-0008036
ECHOBASE:
EB2107
OU-MICROARRAY:
b2437
PortEco:
eutR
STRING:
511145.b2437
COLOMBOS: eutR


Product      
Name: putative AraC-type transcriptional regulator EutR
Synonym(s): EutR, YfeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.16
Isoelectric point: 6.839
Motif(s):
 
Type Positions Sequence
311 -> 334 VKDAAMQWGFWHLGQFATDYQQLF
243 -> 344 SRAREYVLENMSEPVTVLDLCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSMTVKDAAMQWGFWHLGQFATDYQQLFSEKPSLTLHQ
260 -> 281 LDLCNQLHVSRRTLQNAFHAIL
262 -> 342 LCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSMTVKDAAMQWGFWHLGQFATDYQQLFSEKPSLTL
285 -> 285 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
EG12190-MONOMER
ECOLIWIKI:
b2437
INTERPRO:
IPR018060
INTERPRO:
IPR018062
INTERPRO:
IPR009057
MODBASE:
P36547
PFAM:
PF12833
PRIDE:
P36547
PRODB:
PRO_000022549
PROSITE:
PS01124
PROSITE:
PS00041
REFSEQ:
NP_416932
SMART:
SM00342
SMR:
P36547
UNIPROT:
P36547


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB