RegulonDB RegulonDB 10.7: Gene Form
   

glnK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdlB amtB glnK mdlA NtrC TSS_609 TSS_609 glnKp glnKp

Gene      
Name: glnK    Texpresso search in the literature
Synonym(s): ECK0444, EG12191, b0450, ybaI
Genome position(nucleotides): 472598 --> 472936 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.74
External database links:  
ASAP:
ABE-0001562
ECHOBASE:
EB2108
OU-MICROARRAY:
b0450
PORTECO:
glnK
REGULONDB:
b0450
STRING:
511145.b0450
M3D: glnK
COLOMBOS: glnK
PortEco: b0450


Shine dalgarno      
Sequence: aattctgaccGGAGGGgatctATG


Product      
Name: nitrogen regulator GlnK
Synonym(s): GlnK, PII2, YbaI, [protein PII2], nitrogen regulator PII 2, nitrogen regulatory protein GlnK, unmodified protein PII 2
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.259
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
4 -> 105 VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0030234 - enzyme regulator activity
GO:0000166 - nucleotide binding
GO:0042802 - identical protein binding
biological_process GO:0050790 - regulation of catalytic activity
GO:0006808 - regulation of nitrogen utilization
GO:0045848 - positive regulation of nitrogen utilization
Reference(s): [1] van Heeswijk WC., et al., 1996
External database links:  
DIP:
DIP-35006N
ECOCYC:
PROTEIN-PII2
ECOLIWIKI:
b0450
INTERPRO:
IPR002332
INTERPRO:
IPR002187
INTERPRO:
IPR015867
INTERPRO:
IPR017918
INTERPRO:
IPR011322
MINT:
MINT-1309225
MODBASE:
P0AC55
PANTHER:
PTHR30115
PDB:
2NUU
PDB:
2NS1
PDB:
2GNK
PDB:
1GNK
PFAM:
PF00543
PRIDE:
P0AC55
PRINTS:
PR00340
PRODB:
PRO_000022788
PROSITE:
PS00496
PROSITE:
PS00638
PROSITE:
PS51343
PROTEINMODELPORTAL:
P0AC55
REFSEQ:
NP_414984
SMART:
SM00938
SMR:
P0AC55
UNIPROT:
P0AC55


Operon      
Name: glnK-amtB         
Operon arrangement:
Transcription unit        Promoter
glnK-amtB


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, Fur, FNR, NtrC
Repressed by: Fur, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_609 472557 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] van Heeswijk WC., Hoving S., Molenaar D., Stegeman B., Kahn D., Westerhoff HV., 1996, An alternative PII protein in the regulation of glutamine synthetase in Escherichia coli., Mol Microbiol 21(1):133-46

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB