RegulonDB RegulonDB 10.9: Gene Form
   

torD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torA torC torD cbpM

Gene      
Name: torD    Texpresso search in the literature
Synonym(s): ECK0989, EG12195, b0998
Genome position(nucleotides): 1061799 --> 1062398 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0003374
CGSC:
29980
ECHOBASE:
EB2112
ECOLIHUB:
torD
OU-MICROARRAY:
b0998
STRING:
511145.b0998
COLOMBOS: torD


Product      
Name: trimethylamine-N-oxide reductase-specific chaperone
Synonym(s): TorD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.574
Isoelectric point: 4.482
Motif(s):
 
Type Positions Sequence
48 -> 169 PPLTAAVNELENRIATLTVRDDARLELAADFCGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAGMETSGNFNEPADHLAIYLELLSHLHFSLGEGTVPARRIDSLRQKTLTALWQWLPEFV
46 -> 46 S

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042277 - peptide binding
GO:0042802 - identical protein binding
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0006457 - protein folding
GO:0051604 - protein maturation
GO:0051259 - protein complex oligomerization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-11015N
ECOCYC:
EG12195-MONOMER
ECOLIWIKI:
b0998
INTERPRO:
IPR036411
INTERPRO:
IPR020945
INTERPRO:
IPR023069
INTERPRO:
IPR036386
MINT:
P36662
MODBASE:
P36662
PFAM:
PF02613
PRIDE:
P36662
PRODB:
PRO_000024087
REFSEQ:
NP_415518
SMR:
P36662
SWISSMODEL:
P36662
UNIPROT:
P36662


Operon      
Name: torCAD         
Operon arrangement:
Transcription unit        Promoter
torCAD


Transcriptional Regulation      
Display Regulation             
Activated by: TorR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB