RegulonDB RegulonDB 10.8: Gene Form
   

chbG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

katE chbF chbG chbGp5 chbGp5 chbGp4 chbGp4

Gene      
Name: chbG    Texpresso search in the literature
Synonym(s): ECK1731, EG12198, b1733, celG, ydjC
Genome position(nucleotides): 1816386 <-- 1817135 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.47
External database links:  
ASAP:
ABE-0005783
ECHOBASE:
EB2115
OU-MICROARRAY:
b1733
PortEco:
chbG
STRING:
511145.b1733
COLOMBOS: chbG


Product      
Name: chitin disaccharide deacetylase
Synonym(s): CelG, ChbG, YdjC, chitooligosaccharide deacetylase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.774
Isoelectric point: 5.792
Motif(s):
 
Type Positions Sequence
55 -> 55 S
5 -> 237 LIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGMHFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELVSQYLRFIELFGRKPTHLDSHHHVHMFPQIFPIVARFAAEQGIALRADRQMAFDLPVNLRTTQGFSSAFYGEEISESLFLQVLDDAGHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELDVLTSASLKGAIA
61 -> 61 H
6 -> 6 I
48 -> 48 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.4 - polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0019213 - deacetylase activity
GO:0036311 - chitin disaccharide deacetylase activity
biological_process GO:0000272 - polysaccharide catabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006032 - chitin catabolic process
GO:0052777 - diacetylchitobiose catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12198-MONOMER
ECOLIWIKI:
b1733
INTERPRO:
IPR006879
INTERPRO:
IPR022948
INTERPRO:
IPR011330
PANTHER:
PTHR31609
PFAM:
PF04794
PRIDE:
P37794
REFSEQ:
NP_416247
SMR:
P37794
UNIPROT:
P37794


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: NagC, ChbR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter chbGp4 1817242 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter chbGp5 1817312 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB