RegulonDB RegulonDB 10.8: Gene Form
   

yegD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegI yegD alkA Ada anti-anti-terminator anti-terminator terminator yegDp2 yegDp2 alkAp alkAp

Gene      
Name: yegD    Texpresso search in the literature
Synonym(s): ECK2063, EG12200, b2069
Genome position(nucleotides): 2147674 --> 2149026 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.1
External database links:  
ASAP:
ABE-0006856
ECHOBASE:
EB2116
OU-MICROARRAY:
b2069
PortEco:
yegD
STRING:
511145.b2069
COLOMBOS: yegD


Product      
Name: HSP70 family protein YegD
Synonym(s): YegD, actin family protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.371
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
3 -> 228 IGFDYGTANCSVAVMRDGKPHLLKMENDSTLLPSMLCAPTREAVSEWLYRHHDVPADDDETQALLRRAIRYNREEDIDVTAKSVQFGLSSLAQYIDDPEEVWFVKSPKSFLGASGLKPQQVALFEDLVCAMMLHIRQQAQAQLPEAITQAVIGRPINFQGLGGDEANTQAQGILERAAKRAGFRDVVFQYEPVAAGLDYEATLQEEKRVLVVDIGGGTTDCSLLLM
330 -> 422 RQRLSYRLVRSAEECKIALSSVAETRASLPFISNELATLISQRGLESALSQPLTRILEQVQLALDNAQEKPDVIYLTGGSARSPLIKKALAEQ
145 -> 147 LPE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0051787 - misfolded protein binding
GO:0016887 - ATPase activity
GO:0051082 - unfolded protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0031072 - heat shock protein binding
GO:0044183 - protein folding chaperone
biological_process GO:0042026 - protein refolding
GO:0051085 - chaperone cofactor-dependent protein refolding
GO:0006986 - response to unfolded protein
GO:0034620 - cellular response to unfolded protein
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Itoh T., et al., 1999
External database links:  
ECOCYC:
EG12200-MONOMER
ECOLIWIKI:
b2069
INTERPRO:
IPR018181
INTERPRO:
IPR042054
INTERPRO:
IPR013126
MODBASE:
P36928
PANTHER:
PTHR19375
PFAM:
PF00012
PRIDE:
P36928
PROSITE:
PS00329
REFSEQ:
NP_416573
SMR:
P36928
UNIPROT:
P36928


Operon      
Name: yegD         
Operon arrangement:
Transcription unit        Promoter
yegD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegDp2 2147644 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Itoh T., Matsuda H., Mori H., 1999, Phylogenetic analysis of the third hsp70 homolog in Escherichia coli; a novel member of the Hsc66 subfamily and its possible co-chaperone., DNA Res 6(5):299-305

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB