RegulonDB RegulonDB 10.6.3: Gene Form
   

zntA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zntA yhhN tusA ZntR terminator TSS_4075 TSS_4075 zntAp zntAp TSS_4073 (cluster) TSS_4073 (cluster) yhhMp1 yhhMp1

Gene      
Name: zntA    Texpresso search in the literature
Synonym(s): ECK3453, EG12215, b3469, yhhO
Genome position(nucleotides): 3606451 --> 3608649 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.25
External database links:  
ASAP:
ABE-0011332
ECHOBASE:
EB2129
ECOCYC:
EG12215
ECOLIHUB:
zntA
OU-MICROARRAY:
b3469
REGULONDB:
b3469
STRING:
511145.b3469
M3D: zntA
COLOMBOS: zntA
PortEco: b3469


Product      
Name: Zn2+/Cd2+/Pb2+ exporting P-type ATPase
Synonym(s): YhhO, ZntA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 76.84
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
53 -> 109 KVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGY
59 -> 62 CAAC
693 -> 693 K
708 -> 729 WLAVLADTGATVLVTANALRLL
393 -> 393 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.3 - The P-type ATPase (P-ATPase) Superfamily
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0046872 - metal ion binding
GO:0005385 - zinc ion transmembrane transporter activity
GO:0015086 - cadmium ion transmembrane transporter activity
GO:0015087 - cobalt ion transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008551 - cadmium-exporting ATPase activity
GO:0015099 - nickel cation transmembrane transporter activity
GO:0016463 - zinc-exporting ATPase activity
GO:0019829 - cation-transporting ATPase activity
GO:0015094 - lead ion transmembrane transporter activity
biological_process GO:0099132 - ATP hydrolysis coupled cation transmembrane transport
GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0030001 - metal ion transport
GO:0006824 - cobalt ion transport
GO:0006829 - zinc ion transport
GO:0046686 - response to cadmium ion
GO:0010312 - detoxification of zinc ion
GO:0071577 - zinc ion transmembrane transport
GO:0015692 - lead ion transport
GO:0035444 - nickel cation transmembrane transport
GO:0070574 - cadmium ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12947N
ECOCYC:
YHHO-MONOMER
ECOLIWIKI:
b3469
INTERPRO:
IPR027256
INTERPRO:
IPR036412
INTERPRO:
IPR036163
INTERPRO:
IPR023299
INTERPRO:
IPR023298
INTERPRO:
IPR023214
INTERPRO:
IPR018303
INTERPRO:
IPR017969
INTERPRO:
IPR008250
INTERPRO:
IPR006121
INTERPRO:
IPR001757
MINT:
MINT-1256950
MODBASE:
P37617
PANTHER:
PTHR24093:SF126
PANTHER:
PTHR24093
PDB:
1MWY
PDB:
1MWZ
PFAM:
PF00403
PRIDE:
P37617
PRINTS:
PR00120
PRODB:
PRO_000024249
PROSITE:
PS01047
PROSITE:
PS50846
PROSITE:
PS00154
PROTEINMODELPORTAL:
P37617
REFSEQ:
NP_417926
SMR:
P37617
SWISSMODEL:
P37617
UNIPROT:
P37617


Operon      
Name: zntA         
Operon arrangement:
Transcription unit        Promoter
zntA


Transcriptional Regulation      
Display Regulation             
Activated by: ZntR
Growth Conditions:

[1] 

C: Escherichia coli| Luria broth| 30.0 C
E: Escherichia coli| Luria broth| Zn(II) 1.1 mM| 30.0 C

[2] 

C: Escherichia coli| Luria broth| 30.0 C
E: Escherichia coli| Luria broth| Cd(II) 1 to 100 µM| 30.0 C

[3] 

C: Escherichia coli| Luria broth| 30.0 C
E: Escherichia coli| Luria broth| Hg(II) 1 to 10 µM| 30.0 C

[4] 

C: Escherichia coli| Luria broth| 30.0 C
E: Escherichia coli| Luria broth| Pb(II) 0.5 mM| 30.0 C

[5] 

C: Escherichia coli| Luria broth| Zn(II) 1 mM| 30.0 C
E: Escherichia coli| zntR knockout mutant| Luria broth| Zn(II) 1 mM| 30.0 C



RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhhMp1 3605794 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4073 (cluster) 3606028 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4075 3606434 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB