RegulonDB RegulonDB 10.7: Gene Form
   

gadX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gadA gadX gadY TorR RutR FNR GadX GadY TSS_4129 TSS_4129 gadXp gadXp gadYp gadYp

Gene      
Name: gadX    Texpresso search in the literature
Synonym(s): ECK3501, EG12243, b3516, yhiX
Genome position(nucleotides): 3664986 <-- 3665810 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.97
Reference(s): [1] Tramonti A., et al., 2002
External database links:  
ASAP:
ABE-0011487
ECHOBASE:
EB2154
OU-MICROARRAY:
b3516
PORTECO:
gadX
REGULONDB:
b3516
STRING:
511145.b3516
M3D: gadX
COLOMBOS: gadX
PortEco: b3516


Product      
Name: DNA-binding transcriptional dual regulator GadX
Synonym(s): GadX, YhiX
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 31.562
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
164 -> 242 IASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQER
209 -> 232 IKRVAVSCGYHSVSYFIYVFRNYY
145 -> 242 TRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQER
162 -> 183 ARIASELLMSPSLLKKKLREEE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0044212 - transcription regulatory region DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [2] Ma Z., et al., 2002
[1] Tramonti A., et al., 2002
External database links:  
ECOCYC:
EG12243-MONOMER
ECOLIWIKI:
b3516
INTERPRO:
IPR020449
INTERPRO:
IPR009057
INTERPRO:
IPR018060
INTERPRO:
IPR018062
MODBASE:
P37639
PDB:
3MKL
PFAM:
PF12833
PRIDE:
P37639
PRINTS:
PR00032
PRODB:
PRO_000022745
PROSITE:
PS00041
PROSITE:
PS01124
PROTEINMODELPORTAL:
P37639
REFSEQ:
NP_417973
SMART:
SM00342
SMR:
P37639
UNIPROT:
P37639


Operon      
Name: gadAXW         
Operon arrangement:
Transcription unit        Promoter
gadW
gadW
gadX
gadXW
gadAX


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, PhoB, GadE-RcsB, GadW, ArcA, GadE, AdiY
Repressed by: CRP, FNR, H-NS, GadW, TorR, RcsB, Fis, RutR


Regulation by small RNA    
  Display Regulation
small RNA gadY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4129 3667155 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Tramonti A., Visca P., De Canio M., Falconi M., De Biase D., 2002, Functional characterization and regulation of gadX, a gene encoding an AraC/XylS-like transcriptional activator of the Escherichia coli glutamic acid decarboxylase system., J Bacteriol 184(10):2603-13

 [2] Ma Z., Richard H., Tucker DL., Conway T., Foster JW., 2002, Collaborative regulation of Escherichia coli glutamate-dependent acid resistance by two AraC-like regulators, GadX and GadW (YhiW)., J Bacteriol 184(24):7001-12

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB