RegulonDB RegulonDB 10.9: Gene Form
   

bcsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bcsA bcsB bcsZ bcsC bcsQ bcsBp bcsBp

Gene      
Name: bcsB    Texpresso search in the literature
Synonym(s): ECK3517, EG12259, b3532, yhjN
Genome position(nucleotides): 3690268 <-- 3692607 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.91
External database links:  
ASAP:
ABE-0011545
ECHOBASE:
EB2168
ECOLIHUB:
bcsB
OU-MICROARRAY:
b3532
STRING:
511145.b3532
COLOMBOS: bcsB


Product      
Name: cellulose synthase periplasmic subunit
Synonym(s): BcsB, YhjN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 86.024
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
26 -> 779 TPATQPLINAEPAVAAQTEQNPQVGQVMPGVQGADAPVVAQNGPSRDVKLTFAQIAPPPGSMVLRGINPNGSIEFGMRSDEVVTKAMLNLEYTPSPSLLPVQSQLKVYLNDELMGVLPVTKEQLGKKTLAQMPINPLFISDFNRVRLEFVGHYQDVCEKPASTTLWLDVGRSSGLDLTYQTLNVKNDLSHFPVPFFDPSDNRTNTLPMVFAGAPDVGLQQASAIVASWFGSRSGWRGQNFPVLYNQLPDRNAIVFATNDKRPDFLRDHPAVKAPVIEMINHPQNPYVKLLVVFGRDDKDLLQAAKGIAQGNILFRGESVVVNEVKPLLPRKPYDAPNWVRTDRPVTFGELKTYEEQLQSSGLEPAAINVSLNLPPDLYLMRSTGIDMDINYRYTMPPVKDSSRMDISLNNQFLQSFNLSSKQEANRLLLRIPVLQGLLDGKTDVSIPALKLGATNQLRFDFEYMNPMPGGSVDNCITFQPVQNHVVIGDDSTIDFSKYYHFIPMPDLRAFANAGFPFSRMADLSQTITVMPKAPNEAQMETLLNTVGFIGAQTGFPAINLTVTDDGSTIQGKDADIMIIGGIPDKLKDDKQIDLLVQATESWVKTPMRQTPFPGIVPDESDRAAETRSTLTSSGAMAAVIGFQSPYNDQRSVIALLADSPRGYEMLNDAVNDSGKRATMFGSVAVIRESGINSLRVGDVYYVGHLPWFERVWYALANHPILLAVLAAISVILLAWVLWRLLRIISRRRLNPDNE
72 -> 680 DVKLTFAQIAPPPGSMVLRGINPNGSIEFGMRSDEVVTKAMLNLEYTPSPSLLPVQSQLKVYLNDELMGVLPVTKEQLGKKTLAQMPINPLFISDFNRVRLEFVGHYQDVCEKPASTTLWLDVGRSSGLDLTYQTLNVKNDLSHFPVPFFDPSDNRTNTLPMVFAGAPDVGLQQASAIVASWFGSRSGWRGQNFPVLYNQLPDRNAIVFATNDKRPDFLRDHPAVKAPVIEMINHPQNPYVKLLVVFGRDDKDLLQAAKGIAQGNILFRGESVVVNEVKPLLPRKPYDAPNWVRTDRPVTFGELKTYEEQLQSSGLEPAAINVSLNLPPDLYLMRSTGIDMDINYRYTMPPVKDSSRMDISLNNQFLQSFNLSSKQEANRLLLRIPVLQGLLDGKTDVSIPALKLGATNQLRFDFEYMNPMPGGSVDNCITFQPVQNHVVIGDDSTIDFSKYYHFIPMPDLRAFANAGFPFSRMADLSQTITVMPKAPNEAQMETLLNTVGFIGAQTGFPAINLTVTDDGSTIQGKDADIMIIGGIPDKLKDDKQIDLLVQATESWVKTPMRQTPFPGIVPDESDRAAETRSTLTSSGAMAAVIGFQSPYNDQRSVIAL
1 -> 25 MKRKLFWICAVAMGMSAFPSFMTQA
743 -> 763 HPILLAVLAAISVILLAWVLW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006011 - UDP-glucose metabolic process
GO:0030244 - cellulose biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Acheson JF., et al., 2019
[2] Lomize AL., et al., 2017
External database links:  
DIP:
DIP-12386N
ECOCYC:
EG12259-MONOMER
ECOLIWIKI:
b3532
INTERPRO:
IPR018513
INTERPRO:
IPR008979
INTERPRO:
IPR003920
PANTHER:
PTHR39083
PFAM:
PF03170
PRIDE:
P37652
PRINTS:
PR01440
PRODB:
PRO_000022203
REFSEQ:
NP_417989
UNIPROT:
P37652


Operon      
Name: bcsABZC         
Operon arrangement:
Transcription unit        Promoter
bcsBZ
bcsABZC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Acheson JF., Derewenda ZS., Zimmer J., 2019, Architecture of the Cellulose Synthase Outer Membrane Channel and Its Association with the Periplasmic TPR Domain., Structure 27(12):1855-1861.e3

 [2] Lomize AL., Lomize MA., Krolicki SR., Pogozheva ID., 2017, Membranome: a database for proteome-wide analysis of single-pass membrane proteins., Nucleic Acids Res 45(D1):D250-D255


RegulonDB