RegulonDB RegulonDB 10.9: Gene Form
   

yhjR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bcsA bcsE bcsQ yhjR bcsF anti-terminator terminator bcsEp2 bcsEp2 TSS_4137 TSS_4137 bcsEp11 bcsEp11 yhjRp13 yhjRp13 yhjRp11 yhjRp11 yhjRp yhjRp yhjRp5 yhjRp5 bcsEp8 bcsEp8 yhjRp10 yhjRp10 yhjRp12 yhjRp12 bcsBp bcsBp

Gene      
Name: yhjR    Texpresso search in the literature
Synonym(s): ECK3520, EG12262, b3535, bcsR
Genome position(nucleotides): 3695997 <-- 3696185 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.03
External database links:  
ASAP:
ABE-0011551
ECHOBASE:
EB2171
ECOLIHUB:
yhjR
OU-MICROARRAY:
b3535
STRING:
511145.b3535
COLOMBOS: yhjR


Product      
Name: PF10945 family protein YhjR
Synonym(s): BcsR, YhjR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.018
Isoelectric point: 4.113
Motif(s):
 
Type Positions Sequence
18 -> 59 FQNDIVALKQAFSLPDIDYADISQREQLAAALKRWPLLAEFA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0030244 - cellulose biosynthetic process
GO:0090540 - bacterial cellulose biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12262-MONOMER
ECOLIWIKI:
b3535
INTERPRO:
IPR024487
PFAM:
PF10945
PRIDE:
P0ADJ3
REFSEQ:
NP_417992
UNIPROT:
P0ADJ3


Operon      
Name: yhjR         
Operon arrangement:
Transcription unit        Promoter
yhjR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhjRp12 3696215 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhjRp10 3696283 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter bcsEp8 3696322 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhjRp5 3696356 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhjRp11 3696367 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhjRp13 3696375 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter bcsEp11 3696395 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4137 3696397 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB