RegulonDB RegulonDB 10.9: Gene Form
   

yiaM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaN yiaM yiaL

Gene      
Name: yiaM    Texpresso search in the literature
Synonym(s): ECK3566, EG12281, b3577
Genome position(nucleotides): 3744328 --> 3744801 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.09
External database links:  
ASAP:
ABE-0011690
ECHOBASE:
EB2189
ECOLIHUB:
yiaM
STRING:
511145.b3577
COLOMBOS: yiaM


Product      
Name: 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit
Synonym(s): YiaM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.516
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
7 -> 29 AILAINLAVLSCIVFINIILRYG
44 -> 66 LFVWLTFIGAIVAFMDNAHVQVT
113 -> 135 ILGLPIGLMYAACLPTSLVIAFF
17 -> 145 SCIVFINIILRYGFQTSILSVDELSRYLFVWLTFIGAIVAFMDNAHVQVTFLVEKLSPAWQRRVALVTHSLILFICGALAWGATLKTIQDWSDYSPILGLPIGLMYAACLPTSLVIAFFELRHLYQLIT
79 -> 98 RVALVTHSLILFICGALAWG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015144 - carbohydrate transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0015740 - C4-dicarboxylate transport
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
MONOMER0-422
ECOLIWIKI:
b3577
INTERPRO:
IPR007387
PANTHER:
PTHR35011
PFAM:
PF04290
PRIDE:
P37674
PROSITE:
PS51257
REFSEQ:
NP_418034
UNIPROT:
P37674


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB