RegulonDB RegulonDB 10.9: Gene Form
   

yiaO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lyxK yiaN yiaO sgbH

Gene      
Name: yiaO    Texpresso search in the literature
Synonym(s): ECK3568, EG12283, b3579
Genome position(nucleotides): 3746094 --> 3747080 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.17
External database links:  
ASAP:
ABE-0011694
ECHOBASE:
EB2191
ECOLIHUB:
yiaO
OU-MICROARRAY:
b3579
STRING:
511145.b3579
COLOMBOS: yiaO


Product      
Name: 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein
Synonym(s): YiaO
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 35.97
Isoelectric point: 7.19
Motif(s):
 
Type Positions Sequence
1 -> 24 MKLRSVTYALFIAGLAAFSTSSLA
30 -> 312 FGYETSQTDSQHIAAKKFNDLLQERTKGELKLKLFPDSTLGNAQAMISGVRGGTIDMEMSGSNNFAGLSPVMNLLDVPFLFRDTAHAHKTLDGKVGDDLKASLEGKGLKVLAYWENGWRDVTNSRAPVKTPADLKGLKIRTNNSPMNIAAFKVFGANPIPMPFAEVYTGLETRTIDAQEHPINVVWSAKFFEVQKFLSLTHHAYSPLLVVINKAKFDGLSPEFQQALVSSAQEAGNYQRKLVAEDQQKIIDGMKEAGVEVITDLDRKAFSDALGNQVRDMFVK
25 -> 328 AQSLRFGYETSQTDSQHIAAKKFNDLLQERTKGELKLKLFPDSTLGNAQAMISGVRGGTIDMEMSGSNNFAGLSPVMNLLDVPFLFRDTAHAHKTLDGKVGDDLKASLEGKGLKVLAYWENGWRDVTNSRAPVKTPADLKGLKIRTNNSPMNIAAFKVFGANPIPMPFAEVYTGLETRTIDAQEHPINVVWSAKFFEVQKFLSLTHHAYSPLLVVINKAKFDGLSPEFQQALVSSAQEAGNYQRKLVAEDQQKIIDGMKEAGVEVITDLDRKAFSDALGNQVRDMFVKDVPQGADLLKAVDEVQ

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0030246 - carbohydrate binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0008643 - carbohydrate transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12283-MONOMER
ECOLIWIKI:
b3579
INTERPRO:
IPR038404
INTERPRO:
IPR018389
INTERPRO:
IPR004682
PANTHER:
PTHR33376
PFAM:
PF03480
PRIDE:
P37676
REFSEQ:
NP_418036
SMR:
P37676
UNIPROT:
P37676


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB